DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and lct

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_021334700.1 Gene:lct ZFINID:ZDB-GENE-081104-434 Length:1898 Species:Danio rerio

Alignment Length:549 Identity:226/550 (41%)
Similarity:314/550 (57%) Gaps:47/550 (9%)


  Fly    17 GSPVSQTR-----RFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSA 76
            |.|::...     .|...|.|...:::|||||.|.||.||.||||..:|| ..||....|||::.
Zfish  1328 GFPITAEEEILYGHFREGFEWSTATAAYQIEGAWRADGKGLSIWDKFSHT-DSKITQDDNGDIAC 1391

  Fly    77 DSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYNITPMVTI 141
            |||::.:.|:.::|.|.|..||||:|||||:|.|....::.||:.||..|.|.||..||.|.||:
Zfish  1392 DSYNKIEEDINVLKTLGVKHYRFSISWPRILPDGTNRKINEAGLDYYHRLTDALLAANIKPQVTL 1456

  Fly   142 YHWELPQKLQELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAPSY 206
            |||:|||.||::|||.|..|:..|:|||.:|....|:::|.|.|:|||.:|..||||....||..
Zfish  1457 YHWDLPQALQDVGGWENDTIVDRFRDYADVVFNSLGEKIKFWITLNEPLNVAAHGYGYGSQAPGL 1521

  Fly   207 -NYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRDPNSAEDREASERAM 270
             :.||...|...|||:|||||..|:|.:.::.:.||.:.:|:::.|.|.|:|...||.:|:.|.:
Zfish  1522 SDSPGTAPYTVAHNLIKAHAEAWHLYNDQYRAKHGGMISLTMNSDWAEARNPYKQEDVDAARRTI 1586

  Fly   271 QFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRLPEFTTEEIHRIRGTSDFFGINSYT 335
            ||.:|||.||:|.  |:|..:|.:.||..|...|. .:|||||||.||:.||:||.|:||.|.||
Zfish  1587 QFQLGWFAHPVFK--GDYSDLMKDVIRERSLAAGL-PKSRLPEFTPEEVARIKGTHDYFGFNHYT 1648

  Fly   336 SNLVTSNGHNNTGKFPVPSFNHDMG---VVESQEGV------DWPGSGSVWLKVYPKGMYNLLMW 391
            |               |.:||.|.|   .:|:..|.      .|..|||:||||.|.|...:|.:
Zfish  1649 S---------------VLAFNVDYGDQQHIEADRGAGAIRDRTWLDSGSIWLKVAPVGFRKILNF 1698

  Fly   392 IHREYNAPEIIVTENGVSDRG--GLEDYARVDYYNLYLSAVLDA-MEDGANISGYIAWSLMDSYE 453
            |..||..|.:.:||||||::|  .|.|..|:.||..|::..|.| |.||.:|.||.||||||:.|
Zfish  1699 IKEEYGNPPLYITENGVSEQGPENLNDVTRIYYYENYINQALKAYMLDGVDIRGYTAWSLMDNME 1763

  Fly   454 WKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCKTN-TIDWSYRPKLDE----EQQLVAMAQ 513
            |.||::|:|||::|:.:.|...|.||.|...:|.:...| .:....||...|    |..:..:..
Zfish  1764 WAAGYTERFGLFYVNRSDPNFPRIPKKSVWSYATIVSCNGFLSPEERPHKCEVHEPEDDIPGITT 1828

  Fly   514 LP---AEARTS--GASGAVSWSLMGILLL 537
            ||   .|...|  |...:||.:.:|:.:|
Zfish  1829 LPPPVEELSVSFLGLEVSVSNAELGLNVL 1857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 210/488 (43%)
lctXP_021334700.1 Glyco_hydro_1 66..>164 CDD:329037
Glyco_hydro_1 344..810 CDD:329037
Glyco_hydro_1 862..1329 CDD:329037 1/1 (100%)
Glyco_hydro_1 1338..1804 CDD:329037 211/485 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87975486
eggNOG 1 0.900 E1_COG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D257823at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126690
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.