DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and GBA3

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001264154.1 Gene:GBA3 HGNCID:19069 Length:470 Species:Homo sapiens

Alignment Length:467 Identity:184/468 (39%)
Similarity:271/468 (58%) Gaps:34/468 (7%)


  Fly    43 GGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIM 107
            |||:||.||..:||..||...|::.....|||:..||..|:.|::.:|:|.:..|||||||.|::
Human    21 GGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLL 85

  Fly   108 PGGYMNHVSTAGIKYYSNLIDELLRYNITPMVTIYHWELPQKLQELGGWTNPEIIPLFKDYARLV 172
            |.|....::..||.||:.:||:||:..:||:||:||::|||.|::.|||.:..||..|..||:..
Human    86 PDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTLEDQGGWLSEAIIESFDKYAQFC 150

  Fly   173 LEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAPSYNYPGIPAYLCGHNLLKAHAEVVHMYRELFQP 237
            ...:|||||.|.|:||...:....|.:....|...:.|...|...|||:||||...|.|..||:.
Human   151 FSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRK 215

  Fly   238 RQGGRMGITLDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKE 302
            :|.|.:.::|...|.||.||||..|:||::||:.|::..|..|||. .|:||:|:..:|.::|::
Human   216 KQKGMVSLSLFAVWLEPADPNSVSDQEAAKRAITFHLDLFAKPIFI-DGDYPEVVKSQIASMSQK 279

  Fly   303 QGFGARSRLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGK-----------FPVPSFN 356
            ||:.: |||||||.||...|:||:|||.:..||:.|:... .|..|:           ||.||: 
Human   280 QGYPS-SRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQ-ENKKGELGILQDAEIEFFPDPSW- 341

  Fly   357 HDMGVVESQEGVDWPGSGSVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGV--SDRGGLEDYAR 419
                     :.||       |:.|.|.|:..||.:|...||.|.|.:||||.  ||...|:|..|
Human   342 ---------KNVD-------WIYVVPWGVCKLLKYIKDTYNNPVIYITENGFPQSDPAPLDDTQR 390

  Fly   420 VDYYNLYLSAVLDAME-DGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISAR 483
            .:|:......:..|:: |..|:..|.||||:|::||..|:|.:|||:||||..|.|.|.|..||:
Human   391 WEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAK 455

  Fly   484 VFAQLCKTNTID 495
            .:|::.:.|.::
Human   456 EYAKIIRNNGLE 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 183/463 (40%)
GBA3NP_001264154.1 Glyco_hydro_1 21..465 CDD:304882 184/464 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88063951
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001971
OrthoInspector 1 1.000 T610119
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3725
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.