DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU5

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001319275.1 Gene:BGLU5 AraportID:AT1G60260 Length:500 Species:Arabidopsis thaliana

Alignment Length:514 Identity:173/515 (34%)
Similarity:261/515 (51%) Gaps:75/515 (15%)


  Fly     9 FVLTASCLGSPVSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGD 73
            |.....|  |.|.....||..||:|.|:|:||.||....|.:..|:||.|.::.     :..|||
plant    14 FAFPGRC--SDVFSRSDFPEGFLFGAGTSAYQWEGAAAEDGRKPSVWDTLCYSR-----NIGNGD 71

  Fly    74 VSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYNITPM 138
            |:.|.||::|.||:::.:.::..:|||:||.|::|.| ...|:..|:::|.|||.||:.:.|.|.
plant    72 VTCDGYHKYKEDVKLMVDTNLDAFRFSISWSRLIPNG-RGSVNQKGLQFYKNLISELITHGIEPH 135

  Fly   139 VTIYHWELPQKLQ-ELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYM 202
            ||:||::.||.|: |.|||.|..:|..|..|..:....:|:.||.|||:||.......||.....
plant   136 VTLYHYDHPQYLEDEYGGWVNNMMIKDFTAYVDVCFREFGNYVKFWTTINEANVFTIGGYNDGDT 200

  Fly   203 APS-YNYPG---------IPAYLCGHNLLKAHAEVVHMYRELFQPRQGGR-------MGITLDTS 250
            .|. .:.||         ...|:.|||||.|||....:|::.::.:|||.       ||:|..||
plant   201 PPGRCSLPGKNCLLGNSSTETYIVGHNLLLAHASASRLYKQKYKDKQGGSIGFGLYLMGLTPSTS 265

  Fly   251 WPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRLPEFT 315
                    |.:|..|::||..||.|||..|:.  .|:||..|...|           .||||.|:
plant   266 --------SKDDAIATQRAKDFYFGWFLGPLI--FGDYPDTMKRTI-----------GSRLPVFS 309

  Fly   316 TEEIHRIRGTSDFFGINSYTSNLVTS-------NGHNNTGKFPVPSFNHDMGVVESQEG----VD 369
            .||..:::|:|||.|||. .:..||:       :|:        |.|..|||...:..|    ::
plant   310 EEESEQVKGSSDFIGINHXFAASVTNIKFKPSISGN--------PDFYSDMGAYVTYLGNFSVIE 366

  Fly   370 WPGSGSVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVSDRGGLEDYARVDYYNLYLSAVLDAM 434
            :|        |.|..|..:|.:|.:.|:.|.:.:.||| :.....:|..||:|.|.|:..||.::
plant   367 YP--------VAPWTMEAVLEYIKQSYDNPPVYILENG-TPMTQHKDTHRVEYMNAYIGGVLKSI 422

  Fly   435 EDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCKTNT 493
            .:|::..||..||.||.:|....:...:|||.|:|:.|.|.|:|::||..::...|..|
plant   423 RNGSDTRGYFVWSFMDLFELIGRYDYGYGLYSVNFSDPHRKRSPRLSAHWYSDFLKGKT 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 168/499 (34%)
BGLU5NP_001319275.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408001at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.