DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and Klb

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_017455032.1 Gene:Klb RGDID:1308227 Length:777 Species:Rattus norvegicus

Alignment Length:489 Identity:176/490 (36%)
Similarity:256/490 (52%) Gaps:66/490 (13%)


  Fly    18 SPVSQTR-----RFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSAD 77
            |||:..:     .||.:|.||||:.::|:||.|.||.:|.||||....:|...:   ::.|.|.|
  Rat    68 SPVNPGQLFLYDTFPKNFSWGVGTGAFQVEGSWKADGRGPSIWDRYVDSHLRGV---NSTDRSTD 129

  Fly    78 SYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYNITPMVTIY 142
            ||...::|:..:..|.|..|:||:||||:.|.|.:..|:..|::||..|:|.|:..||.|:||:|
  Rat   130 SYVFLEKDLLALDFLGVSFYQFSISWPRLFPNGTVAAVNAKGLQYYRALLDSLVLRNIEPIVTLY 194

  Fly   143 HWELPQKLQ-ELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAPSY 206
            ||:||..|| |.|||.|..:|.||.|||....:.:|||||.|.|::.|:.|..||:|....||..
  Rat   195 HWDLPLTLQEEYGGWKNATMIDLFNDYATYCFQTFGDRVKYWITIHNPYLVAWHGFGTGMHAPGE 259

  Fly   207 NYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRDPNSAEDREASERAMQ 271
            .......|..||||:|||::|.|.|.:.|:|.|.|.:.|||.:.|.||....:.||....:.:|.
  Rat   260 KGNLTAVYTVGHNLIKAHSKVWHNYDKNFRPHQKGWLSITLGSHWIEPNRTENMEDVINCQHSMS 324

  Fly   272 FYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRLPEFTTEEIHRIRGTSDF----FGIN 332
            ..:|||.:||.. .|:||:.|             ...|.:|||:..|...:|||:||    ||.|
  Rat   325 SVLGWFANPIHG-DGDYPEFM-------------KTSSVIPEFSEAEKEEVRGTADFFAFSFGPN 375

  Fly   333 SY-TSNLVTSNGHNNTGKFPVPSFNHDMGVVESQEGVDWPGSGSVWLKVYPKGMYNLLMWIHREY 396
            :: .||.|...|.|       .|.|                            :..:|.||..||
  Rat   376 NFRPSNTVVKMGQN-------VSLN----------------------------LRQVLNWIKLEY 405

  Fly   397 NAPEIIVTENG--VSDRGGLEDYARVDYYNLYLSAVLDAME-DGANISGYIAWSLMDSYEWKAGF 458
            :.|.|:::|||  .......||...:.....:|:.||.|:: |...:.||.||:|:|.:||:..:
  Rat   406 DNPRILISENGWFTDSYIKTEDTTAIYMMKNFLNQVLQAIKFDEIQVFGYTAWTLLDGFEWQDAY 470

  Fly   459 SEKFGLYHVDFNSPQRTRTPKISARVFAQLCKTN 492
            :.:.||::|||||.|:.|.||.||..:.|:.:.|
  Rat   471 TTRRGLFYVDFNSEQKERKPKSSAHYYKQIIQDN 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 172/484 (36%)
KlbXP_017455032.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D257823at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.