DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and Lct

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001074547.1 Gene:Lct MGIID:104576 Length:1931 Species:Mus musculus

Alignment Length:514 Identity:232/515 (45%)
Similarity:310/515 (60%) Gaps:18/515 (3%)


  Fly    26 FPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSADSYHQWKRDVQMVK 90
            ||..|:|...|:|||:||.|.||.||.||||..:|| |.||.:..||||:.||||:...||..::
Mouse  1381 FPKGFIWSAASASYQVEGAWRADGKGLSIWDTFSHT-PLKIGNDDNGDVACDSYHKIAEDVVALQ 1444

  Fly    91 ELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYNITPMVTIYHWELPQKLQELGG 155
            .|.|..||||:|||||:|.|....::.||:.||...||.||...|||.||:|||:|||.||::||
Mouse  1445 NLGVSHYRFSISWPRILPDGTTKFINEAGLNYYVRFIDALLAAGITPQVTMYHWDLPQALQDVGG 1509

  Fly   156 WTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAPSYNY-PGIPAYLCGHN 219
            |.|..::..|||||.::....||:||.|.|:|||:.:..||||....||..:: ||...|..|||
Mouse  1510 WENETVVQRFKDYADVLFRRLGDKVKFWITLNEPFVIAAHGYGSGVSAPGISFRPGTAPYTAGHN 1574

  Fly   220 LLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSK 284
            |:|||||..|:|...::..|||.:.||:.:.|.|||||::.||.||:.|.:||..|||.|||| |
Mouse  1575 LIKAHAEAWHLYNSTYRNSQGGVISITISSDWAEPRDPSNQEDVEAARRYVQFMGGWFAHPIF-K 1638

  Fly   285 HGNYPKVMIERIRNLSKEQGFGARSRLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGK 349
            :|:||:||..|||:.|...|.. :|||||||..|..:|:||.||||.|.||:.|    .:|....
Mouse  1639 NGDYPEVMKTRIRDRSLAAGLN-KSRLPEFTESEKKKIQGTFDFFGFNHYTTVL----AYNLNYA 1698

  Fly   350 FPVPSFNHDMGVVESQEGVDWPGSGSVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVSDRGG- 413
            ..|.||:.|.||....:. .||.|||.|||:.|.|...:|.|:..|||.|.|.|||||||.||. 
Mouse  1699 AAVSSFDADRGVASITDR-SWPDSGSFWLKMTPFGFRRILNWLKEEYNNPLIYVTENGVSRRGDP 1762

  Fly   414 -LEDYARVDYYNLYLSAVLDAMEDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRT 477
             |.|..|:.|...|::..|.|:.|..::.||..||:||::||..||:|:||::.|:.:.|...|.
Mouse  1763 ELNDTDRIYYLRSYINEALKAVRDKVDLRGYTVWSIMDNFEWATGFAERFGVHFVNRSDPSLPRI 1827

  Fly   478 PKISARVFAQLCKTNTIDWSYRPKLDEEQQLVAMAQLPAEARTSGASGAVSWSLMGILL 536
            ||.||:|:|.:.:.|...       |..|......|.|.:|..:.:........:|::|
Mouse  1828 PKASAKVYASIVRCNGFP-------DPAQGPHPCLQQPEDAGPTASPVKSEVPFLGLML 1879

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 224/469 (48%)
LctNP_001074547.1 Glyco_hydro_1 86..>223 CDD:304882
Glyco_hydro_1 380..849 CDD:304882
Glyco_hydro_1 902..1368 CDD:278653
Glyco_hydro_1 1377..1844 CDD:278653 225/471 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87986888
eggNOG 1 0.900 E1_COG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616923
orthoMCL 1 0.900 OOG5_126690
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3725
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.