DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and klo-1

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_501271.1 Gene:klo-1 WormBaseID:WBGene00016848 Length:479 Species:Caenorhabditis elegans

Alignment Length:486 Identity:161/487 (33%)
Similarity:258/487 (53%) Gaps:41/487 (8%)


  Fly    20 VSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSADSYHQWKR 84
            :|...:||.:|.....:::|||||..|.|.:|.|.||.: .:...:|.|.|:.|:|.:...::|.
 Worm     1 MSLPTKFPKNFQLATATAAYQIEGAKNLDGRGFSTWDSI-RSENGRIHDNSDPDLSCEGRLKYKE 64

  Fly    85 DVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYN-ITPMVTIYHWELPQ 148
            ||.::.::.|.:||||:||.||:|.|.:..::..||::|.: |..|||.| |.|:||::|:::|.
 Worm    65 DVALLSKIGVTSYRFSISWSRILPDGTLKTINEDGIQFYRD-ICLLLRDNGIEPIVTLFHFDMPL 128

  Fly   149 KLQELG-GWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNE----PWHVCEHGYGVDYMAPS--- 205
            .:.:.| .|.|.|....|:.:|.|..:.:||.||.|.|.||    .|.......|..::.|.   
 Worm   129 SIYDNGTSWLNKENCEHFEKFADLCFQKFGDLVKTWITFNEINMQAWSSVVKIEGELWLCPDRPE 193

  Fly   206 -YNYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRDPNSAEDREASERA 269
             .|:...| |:...|:|..||::...|::.::..|.|.:|||....:..|.. :|..|.:|..||
 Worm   194 IENHEQAP-YIAATNMLLTHAKIYRNYQKNYKETQNGLIGITNGGRFCLPAS-DSPADLDACNRA 256

  Fly   270 MQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRLPEFTTEEIHRIRGTSDFFGINSY 334
            :.:...:...||.:..|::|..|.|::            ..||:|:.||...|:|::||.|||.|
 Worm   257 LDWLFNYTIEPILTDSGDFPASMREKL------------PFLPKFSEEEKKLIKGSTDFLGINYY 309

  Fly   335 TSNLVTSNGHNNTGKFPVPSFNHDMGVVESQEGVDWPG-SGSVWLKVYPKGMYNLLMWIHREYNA 398
            .|::|.   :.|.|:.|......| ......|| .|.. .|..|::..|.|::.||.::..:||.
 Worm   310 LSHIVR---NLNDGEEPASQSERD-AAYAFNEG-KWEKICGETWVRYAPDGLFGLLKYVRDKYNN 369

  Fly   399 PEIIVTENGVSDRGG---------LEDYARVDYYNLYLSAVLDAMEDGANISGYIAWSLMDSYEW 454
            ..:.:||||..|..|         |:|..|:.:.:.:|.||..|:|:|.|:.||..|:|||::||
 Worm   370 IPVFITENGCMDLVGGEGRKEEEILDDKHRIKFISGHLEAVAKALEEGCNVIGYTLWTLMDNFEW 434

  Fly   455 KAGFSEKFGLYHVDFNSPQRTRTPKISARVF 485
            ..||..|||:..|||:||.:|||.|.||:.:
 Worm   435 DDGFGVKFGICRVDFDSPDKTRTMKYSAKYY 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 160/485 (33%)
klo-1NP_501271.1 Glyco_hydro_1 7..470 CDD:304882 160/481 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134650895
eggNOG 1 0.900 E1_COG2723
Hieranoid 1 1.000
Homologene 1 1.000 H75140
Inparanoid 1 1.050 266 1.000 Inparanoid score I1850
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D257823at33208
OrthoFinder 1 1.000 FOG0001971
OrthoInspector 1 1.000 T374687
orthoMCL 1 0.900 OOG5_126690
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3725
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.