DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx8 and Syx7

Sequence 1:NP_524113.1 Gene:Syx8 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster

Alignment Length:230 Identity:42/231 (18%)
Similarity:99/231 (43%) Gaps:38/231 (16%)


  Fly    21 HQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAK-DMKHLKVVLDNAI---TWETSPEEELQQ 81
            ||::.|.|             ||.:.....|.::.| ..:|||:..|..:   |...:..:.:|:
  Fly    65 HQIMTYTN-------------QLVTDTNNQINEVDKCKERHLKIQRDRLVDEFTAALTAFQSVQR 116

  Fly    82 RRIDWDRLTSQLREIREKFANSSR---SNVPAASGSAWQDQDLGPGHSNS----------SRNTA 133
            :..|.::  :.||:.|....|.:|   |:...:|.|:...||     :||          |....
  Fly   117 KTADIEK--TALRQARGDSYNIARPPGSSRTGSSNSSASQQD-----NNSFFEDNFFNRKSNQQQ 174

  Fly   134 LDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQR 198
            :..:..:|...:.|.:|.:.:..|...:....::..:||..|.:|...:|::.:.:::....|.:
  Fly   175 MQTQMEEQADLQALEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQ 239

  Fly   199 ETQSIGQVNR-RDSTWGYWLVIIALFVAIIVVVFV 232
            .|:::.:.:. |:......|:::.:..|:::.:.:
  Fly   240 GTENLRKASSYRNKVRKKKLILVGILSAVLLAIIL 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 10/58 (17%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 15/76 (20%)
COG5325 <97..276 CDD:227635 31/186 (17%)
SNARE 188..247 CDD:304603 10/59 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19957
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.