DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and Adcy5

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_072122.1 Gene:Adcy5 RGDID:71014 Length:1262 Species:Rattus norvegicus

Alignment Length:1581 Identity:577/1582 (36%)
Similarity:807/1582 (51%) Gaps:418/1582 (26%)


  Fly     1 MSGG-----PGAGSGGAVAGGVGGGATHIFRSLSSESQKREWSKRLSLRGMRHGGAAGGPGGS-- 58
            |||.     ||..:..|.:....||..|          :..|.:..|    |..|....||||  
  Rat     1 MSGSKSVSPPGYAAQTAASPAPRGGPEH----------RAAWGEADS----RANGYPHAPGGSTR 51

  Fly    59 GTSSLASSKEESKHRKFFSRSASLRQAG--------SGG----GGVGV-----------GGVVGG 100
            |::..:......:.::   |.||..:.|        ||.    ||.|.           ||..||
  Rat    52 GSTKRSGGAVTPQQQQ---RLASRWRGGDDDEDPPLSGDDPLVGGFGFSFRSKSAWQERGGDDGG 113

  Fly   101 SGSHQASMELHVPGQEGRGTSSGAGSPQTQTQPSTPKKSNWEVIEHFNTSAKGGKAVVSSSLIAA 165
            .||.          ::.|| ::|.||  |:..|:                  ||....:::..||
  Rat   114 RGSR----------RQRRG-AAGGGS--TRAPPA------------------GGSGSSAAAAAAA 147

  Fly   166 GITRC---NIDESMDSTNSSSTCHSPMIYQRDETQLLQPGDASNLEANNPMSSGGGGGTANGPVS 227
            |.|..   :::..::...........:   ...|..::.||.|. :..:.::||.|.||.....:
  Rat   148 GGTEVRPRSVEVGLEERRGKGRAAEEL---EPGTGTVEDGDGSE-DGGSSVASGSGTGTVLSLGA 208

  Fly   228 PSISFWFRLNRIILRLCSTHQFKNLQVEMLYQRYFLRMNQSNTTHILALLLALILALSCTLLVFT 292
            ..::        :|::..:.:|.:.::|.||||||.|:|||:.|.::|:|:.:.|    .:|.| 
  Rat   209 CCLA--------LLQIFRSKKFPSDKLERLYQRYFFRLNQSSLTMLMAVLVLVCL----VMLAF- 260

  Fly   293 TLQLRRSTSLLLEISEIGLDANATVGNLTTATMKPPTLASSDQMTRGSSIPLLALASNGSWAGNG 357
                                                                             
  Rat   261 ----------------------------------------------------------------- 260

  Fly   358 AVGGELKSAHNHNIADFEADHNGQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRMREKRSLQD 422
                                                                             
  Rat   261 ----------------------------------------------------------------- 260

  Fly   423 AGLVKGGGIQTQLIVDTATDDDADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYNQISHAERD 487
                                                                        ||.| 
  Rat   261 ------------------------------------------------------------HAAR- 264

  Fly   488 EVLNTSSNAGVATDNSDPPLGYGQLIPLILMQVDESVLVFLIVMLICGIVYAFLLCILSKPAMNE 552
                             |||   |::.|.::..  :|.|.||:.::|           ::.|.::
  Rat   265 -----------------PPL---QVVYLAVLAA--AVGVILIMAVLC-----------NRAAFHQ 296

  Fly   553 IFLVLVSYVILGTFLAIEVAVSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVV 617
            ..:.|..|.::...||::|......||..:..|....:..||..||:||:|:|.|::.|:|||.:
  Rat   297 DHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL 361

  Fly   618 HLYTCLRLNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLR 682
            ||...|..|| ||:.:    .::|:..::.....|:.||.||:|.|.:||:||.|||:||:|||.
  Rat   362 HLAISLHTNA-QDQFL----LKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH 421

  Fly   683 TQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQC 747
            :||||||||||||||||||||||||.||..:..|..|||||||:|:|||||||||.|||||:.||
  Rat   422 SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQC 486

  Fly   748 TAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIAL 812
            ||:|||..|||||||||:||||:||||||:|||||||||||||.|.|||||.||||:|||:||:.
  Rat   487 TAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISS 551

  Fly   813 VREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLD 877
            ||||..||||||||||:||||||||||.||||||||||||||||||:||..||:||||.||..|:
  Rat   552 VREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLN 616

  Fly   878 GDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKS----RNRLQVN--------------- 923
            ||||||.|.|.|||:|||:|.|||:||:.....|..:|:    .||.:.|               
  Rat   617 GDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPF 681

  Fly   924 -----GN-ISKELRMMGHGTAQKHTSKFGFGD----SSESAKDPEDEVNEYLMRAIDARSIDHLR 978
                 || :|||::.|            ||.|    :::.:.:|||||:|:|.|||||||||.||
  Rat   682 YNHLGGNQVSKEMKRM------------GFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLR 734

  Fly   979 AEHCQSLLLCFKDNVLERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALL 1043
            :||.:..||.|::..||:||:.:.|.....|..|:.||.|....:::.:...||..|:......|
  Rat   735 SEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIVPHSLFMLSFYLSCFL 799

  Fly  1044 LLGFLVF---LVACHKINFQLPSDIKRFSLRIHSNRRISQLFAFASVALIVLTTLLAMFQESGRQ 1105
            ||..:||   :.||.|:   .|:.::..|.:|..:::.|.|....::.|:.|:..:.||..:.:.
  Rat   800 LLALVVFISVIYACVKL---FPTPLQTLSRKIVRSKKNSTLVGVFTITLVFLSAFVNMFMCNSKN 861

  Fly  1106 ME--LLQRRRFWLDVNGSISLNDTELNTKMYDAE------EPDCDF--YLAYNTFLLLTLLSMMS 1160
            :.  |.:.....::...:..:.::..|..:.|.:      :.:|:|  |..|:     .|||:::
  Rat   862 LVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGSPQSNCNFPEYFTYS-----VLLSLLA 921

  Fly  1161 CATYQVLRILLKLLLL-----------------------LLASGSYMACSSNLYSRSREMSQELA 1202
            |:.:..:..:.||:|:                       ||.:.:.:..|:|..|:..|.:.::|
  Rat   922 CSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLVTANAIDFSNNGTSQCPEHATKVA 986

  Fly  1203 NEEALLRYIIDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENIL 1267
            .:      ::..|.:..|:|||..|:.|.|:|.||||:||||||||||:||.||||||:||.|||
  Rat   987 LK------VVTPIIISVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNIL 1045

  Fly  1268 PVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDE 1332
            |..||.|||:||:..|:||::.|:.|.::||||.||||||||||.||||||||||||||||||||
  Rat  1046 PKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDE 1110

  Fly  1333 LLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFR 1397
            ::||:|||.:||||:.|:||||||||..:|.|:...:|:.|:||:|::|.|:::.:|.||||||:
  Rat  1111 IISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAGKTHIKALADFAMKLMDQMKYINEHSFNNFQ 1175

  Fly  1398 MRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRG 1462
            |:||:||||||||||||.|||||||||.|||||||||||:.|.||||.:|.|:|....::|.|||
  Rat  1176 MKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRG 1240

  Fly  1463 SVDVKGKGSMITYFLKGRRPI 1483
            .|.|||||.|:||||.|..|:
  Rat  1241 VVKVKGKGEMMTYFLNGGPPL 1261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 82/197 (42%)
CYCc 686..881 CDD:214485 157/195 (81%)
Guanylate_cyc 722..895 CDD:278633 139/173 (80%)
DUF1053 <949..1005 CDD:283888 29/60 (48%)
CYCc 1259..1455 CDD:214485 131/196 (67%)
Guanylate_cyc 1285..1479 CDD:278633 130/194 (67%)
Adcy5NP_072122.1 AC_N 1..459 CDD:292831 164/752 (22%)
CYCc 425..620 CDD:214485 157/195 (81%)
Guanylate_cyc 461..634 CDD:278633 139/173 (80%)
DUF1053 669..761 CDD:283888 37/104 (36%)
CYCc 1037..1238 CDD:214485 132/201 (66%)
Guanylate_cyc 1063..1257 CDD:278633 130/194 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C331177847
eggNOG 1 0.900 E1_COG2114
Hieranoid 1 1.000
Homologene 1 1.000 H11213
Inparanoid 1 1.050 951 1.000 Inparanoid score I311
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 1 1.000 T617441
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45627
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.