DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and adcy6a

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_017209219.1 Gene:adcy6a ZFINID:ZDB-GENE-060221-1 Length:1203 Species:Danio rerio

Alignment Length:1523 Identity:551/1524 (36%)
Similarity:777/1524 (51%) Gaps:405/1524 (27%)


  Fly    31 ESQKREWSKRLSLRGMRHGGAAGGPGGSGTSSLASSKEESKHRKFFS-----RSASLRQAGSGGG 90
            :.:|..|.:|...:..|..|          |||.:.:..|..|...:     :....:...|||.
Zfish    13 DDRKTAWGERNGKKSKRKVG----------SSLCNPRYMSCLRDVEAMEPPPQPPHAQATRSGGP 67

  Fly    91 GVGVGGVVGGSGSHQASMELHVPGQEGRGTSSGAGSPQTQTQPSTPKKSNWEVIEHFNTSAKGGK 155
            |.|.||..||:|:.              |...|                 |:. :|:.....||:
Zfish    68 GGGPGGGPGGTGNF--------------GMRCG-----------------WQE-DHYGKMGSGGE 100

  Fly   156 AVVSSSLIAAGITRCNIDESMDSTNSSSTCHSPMIYQRDETQLLQPGDASNLEANNPMSSGGGGG 220
            .|        |:...::.                         .:.||....:.:.....|....
Zfish   101 GV--------GLKSVDLG-------------------------FEDGDVKGRKRDGLGGDGSSED 132

  Fly   221 TANGPVS-PSISFWFRLNRIILRLCSTHQFKNLQVEMLYQRYFLRMNQSNTTHILALLLALILAL 284
            ||:|..| .:...|.|    ::|:..:.:|::.::|.||||||.|:|||:    |.:|:.:::.:
Zfish   133 TASGTGSVTAADCWQR----VVRVFQSKKFQSRKLERLYQRYFFRLNQSS----LTMLMGVLVIV 189

  Fly   285 SCTLLVFTTLQLRRSTSLLLEISEIGLDANATVGNLTTATMKPPTLASSDQMTRGSSIPLLALAS 349
            ...:|.|                                                          
Zfish   190 CGVMLTF---------------------------------------------------------- 196

  Fly   350 NGSWAGNGAVGGELKSAHNHNIADFEADHNGQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRM 414
                                                                             
Zfish   197 ----------------------------------------------------------------- 196

  Fly   415 REKRSLQDAGLVKGGGIQTQLIVDTATDDDADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYN 479
                                                                 |..:.|      
Zfish   197 -----------------------------------------------------HCIHGP------ 202

  Fly   480 QISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPLILMQVDESVLVFLIVMLICGIVYAFLLCI 544
                                     |.:.|..::.:       ::.:||.:|::|          
Zfish   203 -------------------------PDVVYASVLSV-------AMALFLALMVVC---------- 225

  Fly   545 LSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALI 609
             ::...::.::.:|||:::|..:.::|.....:.|..:..|....:..||:.||:||:|:|.|::
Zfish   226 -NRNGFHQDYMWMVSYLVIGVLIIVQVFGVLMVAPRSASEGIWWSVFFIYIIYTLLPVRMRAAVL 289

  Fly   610 GGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETR 674
            .|.:||.:||.|..|:|  ||:  |.: |::|...::..|..|:.|:.||:|.|.:||:||.|||
Zfish   290 SGGVLSAIHLLTTWRIN--QDD--EFL-WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETR 349

  Fly   675 QCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICG 739
            ..|:|||..||||||||||||||||||||||||.||..:..|..|||||||:|:|||||||||.|
Zfish   350 GYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEG 414

  Fly   740 FTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGL 804
            ||||:.||||:|||..|||||||||:||:|:||||||:|||||||||||||||.|||||.||||:
Zfish   415 FTSLASQCTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGV 479

  Fly   805 DMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHIT 869
            |||:||:|||||..||||||||||:||||||||||.||||||||||||||||||:||..||:|||
Zfish   480 DMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHIT 544

  Fly   870 KETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKS----RNRLQVNGN----- 925
            |.||:.|:||||||.|.|.|||:|||::.|||:|::.....|..:|:    ..|.:.|.|     
Zfish   545 KATLQYLNGDYEVEPGFGGERNAYLKENSIETFLVLGCSQKRKDEKAMMAKMQRTRTNSNEALVP 609

  Fly   926 ------------ISKELRMMGHGTAQKHTSKFGFGDSSESAKDPEDEVNEYLMRAIDARSIDHLR 978
                        .||..|.||   ..:.:||...|  ::.|.:|||||:|:|.|||||||||.||
Zfish   610 RWVPDRSFSRTKDSKVFRQMG---IDETSSKDNRG--AQEALNPEDEVDEFLGRAIDARSIDQLR 669

  Fly   979 AEHCQSLLLCFKDNVLERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALL 1043
            .:|.:..||.|:.:.||:|||.:.|.....|..|:|||....|.:::|||..:|:.|.:.....:
Zfish   670 KDHVKKFLLTFQTSSLEKKYAKKVDDRFGGYVACTLLVFCFISFIQIVVFPHTLVMLGIYISIFI 734

  Fly  1044 LLGFLVFLVACHKINFQLPSDIKRFSLRIHSNRRISQLFAFASVALIVLTTLLAMFQ-ESGRQME 1107
            :|..::|:.|.:......|:.::..|.:|..:|..|.|....::.|:.::..:.||. ::.:.::
Zfish   735 ILANILFICAIYSCVKLFPAAMQTVSKKIVQSRTNSTLVGVFTIILVFISAFVNMFSCDTQKLVD 799

  Fly  1108 LLQRRRFWLD---------------VNG-SISLNDTELNTKMYDAEEPDCDF--YLAYNTFLLLT 1154
            .:.::..|..               .:| ||..|:|           |.|.|  |.:|:     .
Zfish   800 CVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNT-----------PSCPFPEYFSYS-----V 848

  Fly  1155 LLSMMSCATY-QV-------LRILLKLLLLLLASGSYMACSSN----------LYSRSREMSQ-E 1200
            ||::::|:.: |:       |.:|::|..|||.....:|...|          :::.:.:.|. .
Zfish   849 LLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANALVFNETLQWSNFN 913

  Fly  1201 LANEEALLRY------IIDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYN 1259
            ...|:...|.      ::..:.|..|:|||..|:.|.|:|.||||:||||||||||:||.|||||
Zfish   914 TTTEQCTFRVTKVSLKVMTPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYN 978

  Fly  1260 RKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLN 1324
            |:||.||||..||.|||:||:..|:||::.|:.|.::||||.||||||||||.||||||||||||
Zfish   979 RRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLN 1043

  Fly  1325 EIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVN 1389
            ||||||||::|||::|.:||||:.|:||||||||..:|.|:...||:||:||||:.|.::::.:|
Zfish  1044 EIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLREQMKYIN 1108

  Fly  1390 MHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGR 1454
            .||||||:|:||:||||||||||||.|||||||||.|||||||||||:.|.||||.::.|:|..:
Zfish  1109 EHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLHQVLHSK 1173

  Fly  1455 GFELTCRGSVDVKGKGSMITYFLKGRRP 1482
            |::|.|||.:.|||||.|.||||....|
Zfish  1174 GYQLECRGVIKVKGKGEMTTYFLNDGPP 1201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 79/197 (40%)
CYCc 686..881 CDD:214485 158/195 (81%)
Guanylate_cyc 722..895 CDD:278633 140/173 (81%)
DUF1053 <949..1005 CDD:283888 29/56 (52%)
CYCc 1259..1455 CDD:214485 131/196 (67%)
Guanylate_cyc 1285..1479 CDD:278633 130/194 (67%)
adcy6aXP_017209219.1 AC_N <97..395 CDD:318454 113/569 (20%)
Guanylate_cyc 397..570 CDD:306677 140/173 (81%)
DUF1053 609..696 CDD:310728 37/92 (40%)
Guanylate_cyc 1004..1197 CDD:306677 130/193 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 940 1.000 Inparanoid score I322
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 1 1.000 T596020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4931
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.