DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and adcy6b

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_002666536.2 Gene:adcy6b ZFINID:ZDB-GENE-090127-2 Length:1174 Species:Danio rerio

Alignment Length:1230 Identity:515/1231 (42%)
Similarity:719/1231 (58%) Gaps:168/1231 (14%)


  Fly   352 SWAGNGAVGGELKSAH--NHNIADFEADHNGQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRM 414
            ||. ||     .|:|.  ||..|  ..:.||    |:.:||....|...||..          .:
Zfish     2 SWV-NG-----FKAARVDNHKTA--WGERNG----RKSRRKRGSSLCNPRYMS----------CL 44

  Fly   415 REKRSLQ--------DAGLVKGGGIQTQLI----------------VDTATDDDADVYTVASDDD 455
            |:..|::        .||........|:.:                ||.|. :||:.....:.||
Zfish    45 RDPESMEAPSQQYSRAAGGATSSNFSTRCVWQEDHYGRKGDVGLRAVDLAF-EDAETRQTKNGDD 108

  Fly   456 DDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPLILMQV 520
            .|..|....|.....:|..:|    ::|..:.:...::.              ..:|......::
Zfish   109 PDEGGVERKGPDRCFFTCLLR----LAHIFQSKKFKSAK--------------LERLYQRYFFRL 155

  Fly   521 DESVLVFL--IVMLICGIVYAF------------------------LLCILSKPAMNEIFLVLVS 559
            ::|.|..|  :::::||::.||                        |:.:.::...::.::.:||
Zfish   156 NQSSLTMLMGVLVVVCGVMLAFHCVQGPPDVAYASVLSVAMGLFLTLMVVCNRNGFHQDYMWIVS 220

  Fly   560 YVILGTFLAIEVAVSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLR 624
            |:::|..:.::|.....:.|.....|....:..||:.||:||:|:|.|:|.|.:||.:|:....|
Zfish   221 YLVMGVLVVVQVFGLLMVDPPSMPEGIWWTVFFIYIIYTLLPVRMRAAVITGAVLSTIHIVMAWR 285

  Fly   625 LNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQ 689
            .| ::|..:    :::|....:..|..|:.|:.||:|.|.:||:||.|||..|:||:..||||||
Zfish   286 FN-LEDSFL----YKQLCANAMIFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQ 345

  Fly   690 QERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVR 754
            ||||||||||||||||||.||..:..|..|||||||:|:|||||||||.|||||:.||||:|||.
Zfish   346 QERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVM 410

  Fly   755 LLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAV 819
            .|||||||||:||.|:||||||:|||||||||||||||.|||||.||||:|||:||:|||||..|
Zfish   411 TLNELFARFDKLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGV 475

  Fly   820 NVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEV 884
            |||||||||:||||||||||.|||||||||||||||.||:||..||:||||.||:.|:||||||.
Zfish   476 NVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEA 540

  Fly   885 GKGNERNSYLKDHQIETYLIVPGDIYRPHKKS----RNRLQVNGN-----------------ISK 928
            |.|.:||:||.::.|||:.::.....|..:|:    ..|.:.|.:                 .||
Zfish   541 GFGGDRNAYLNNNNIETFFVLGCSQKRKEEKAMMAKMQRARANSSEGLMPRWVPDRSFSRTKDSK 605

  Fly   929 ELRMMGHGTAQKHTSKFGFGDSSESAKDPEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNV 993
            ..|.||...|....::     .::.|.:|||||:|:|.|||||||||.||.:|.:..||.|:..:
Zfish   606 VFRQMGIDEASSKDNR-----CAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLTFQTPL 665

  Fly   994 LERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKIN 1058
            ||:||:.:.|.....|..|:|||......:::|:|..:.|.|.|.....::|..::|:.|.:...
Zfish   666 LEKKYSKKVDDRFGGYVACTLLVFCFIVFIQIVIFPHTPLMLGLFITIFIILAHVLFICAIYSCV 730

  Fly  1059 FQLPSDIKRFSLRIHSNRRISQLFAFASVALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSIS 1123
            ...|..::..|.||..:|..|.|....::.|:.::..:.||        ...|......|.|.::
Zfish   731 KLFPVTLQTVSKRIVQSRINSTLVGVFTILLLFISAFVNMF--------TCDRTDMLACVAGHLN 787

  Fly  1124 LNDTELNTKMYD----AEEPDCDFYLAYNT---------FLLLTLLSMMSCATY--------QVL 1167
            ::::.....:|:    ||:|   |:|..:.         |....||:::.|:.:        .||
Zfish   788 ISESVTLCLLYNLSGLAEDP---FFLCLDQPSACPLPEYFTYSVLLTLLCCSVFLHISSIGKLVL 849

  Fly  1168 RILLKLLLLLLASGSYMACSSN---------LYS-RSREMSQELANEEALLRYIIDSIFLFAFML 1222
            .:.:::..|||.....::...|         ||: ......||...:.:|...|  .:.|..|:|
Zfish   850 MLFIQICFLLLIEWPLVSLLDNADLLDTVDALYAFNETNYCQETVTKVSLRVSI--PVILTVFVL 912

  Fly  1223 ALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYH 1287
            ||..|:.|.|:|.||||:||||||||||:||.||||||:||.||||..||.|||:||:..|:||:
Zfish   913 ALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYY 977

  Fly  1288 EQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATY 1352
            :.|:.|.::||||.||||||.|||.||||||||||||||||||||::|||:::.:||||:.|:||
Zfish   978 QSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADFDEIISEEKYKQLEKIKTIGSTY 1042

  Fly  1353 MAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKP 1417
            ||||||..:|.|:...:|:.|:||||::|.::::.:|.||||||:|:||:||||||||||||.||
Zfish  1043 MAASGLNDSTYDKEGRTHILALADYAMRLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKP 1107

  Fly  1418 QYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFL 1477
            |||||||.|||||||||||:.|.||||.::..:||.:|::|.|||.|.|||||.|.||||
Zfish  1108 QYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHVLESKGYQLECRGLVKVKGKGDMTTYFL 1167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 78/223 (35%)
CYCc 686..881 CDD:214485 157/195 (81%)
Guanylate_cyc 722..895 CDD:278633 138/173 (80%)
DUF1053 <949..1005 CDD:283888 28/56 (50%)
CYCc 1259..1455 CDD:214485 127/196 (65%)
Guanylate_cyc 1285..1479 CDD:278633 127/194 (65%)
adcy6bXP_002666536.2 AC_N 15..376 CDD:318454 107/401 (27%)
Guanylate_cyc 378..562 CDD:306677 141/184 (77%)
DUF1053 590..677 CDD:310728 34/92 (37%)
Guanylate_cyc 975..1169 CDD:306677 127/194 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 1 1.000 T596020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4931
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.