DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and adcy2b

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio

Alignment Length:1170 Identity:417/1171 (36%)
Similarity:621/1171 (53%) Gaps:205/1171 (18%)


  Fly   442 DDDADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPP 506
            :|:.:.:....:||::|.|        :...|.   :.|.::     :|....:.||::.....|
Zfish    29 EDEPERHKQQDEDDEEVSG--------VQQDPM---FQQTAY-----LLEGPEDMGVSSCGLKSP 77

  Fly   507 -------LGYGQLIPLILMQVDESVLVFLIVMLICGIVYAFLLC-----------ILSKPAMNEI 553
                   ....|..|||       |.:.||||..|..:.|....           |::.|....|
Zfish    78 DWVYESYYRMSQQHPLI-------VFLLLIVMGACLALLAVFFASGLDMEEHMAFIMTVPTTLAI 135

  Fly   554 FLV----------------LVSYVILGTFLAIEVAVSYAMQPSKSFNGSACC--------IVLIY 594
            ||.                |.|.:|.|..    ||:.|...    |.|...|        :.:::
Zfish   136 FLAIFILVCIESVFKKLLRLFSLLIWGCL----VAMGYLFM----FFGGIICPWDQVSFFLFIVF 192

  Fly   595 MTYTMLPLRLREALIGGILLSVVH---LYTCLRLNAMQDEAVEMIHWEELLCTLVALLLANLTGV 656
            :.|||||..:|:|:|..:|.|..|   |..||   :...:.:|.:.| ::|..::..:..|:.|.
Zfish   193 VVYTMLPFSMRDAVIASVLTSSSHTLVLSICL---SNTSDHMEALVW-QILANIIIFICGNVAGA 253

  Fly   657 YTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIA--------GQ 713
            |.....:.|.::.:.:|..||::.::.:.|..||||||||:||.|:|..||.:|.        .|
Zfish   254 YHKHLMDLALKQTYHDTCNCIKSPIKLEFEKHQQERLLLSLLPAHIARVMKAEIIQRLKGPNFSQ 318

  Fly   714 PRDT-QFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKL 777
            ..:| .||.:|:|||.|||||:|||.|||.|:..|:..|||.:|||||.:||::|.::.|:|||:
Zfish   319 AENTNNFHNLYVQRHTNVSILYADIVGFTRLASDCSPGELVYMLNELFGKFDQIAKDNDCMRIKI 383

  Fly   778 LGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKW 842
            ||||||||||||:|..|||...|:|||||.:||..|||...|::|||||:|:|.|.|||:||.||
Zfish   384 LGDCYYCVSGLPDPLLDHAKNCVKMGLDMCEAIEKVREATGVDINMRVGVHSGNVLCGVIGLQKW 448

  Fly   843 QFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPG 907
            |:||||:|||||||||:||:||||||:..||:.|:|.|:||.|.|..|:||||:|.|.|||::  
Zfish   449 QYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEQGNGQSRDSYLKEHGIVTYLVI-- 511

  Fly   908 DIYRPHKKSRNRLQV-------------------------------------------NGNISKE 929
               .|..:.|:.|.:                                           ||.|:..
Zfish   512 ---NPKAEKRSPLLLSAIRPTMYGAKMRASVRMTQYLESWGAAKPFANLHHRDSMTNENGMINTR 573

  Fly   930 LRMMGHGTAQKHTSKFGFGDSSESAKDPEDEVNEYLMRAIDARSIDH--LRAEHCQSLLLCFKDN 992
            ...:|....|:.:.:     :....|..|:|:||.::|.||..:...  |::|..|.:.|.|.:.
Zfish   574 DVPLGQYNCQQRSER-----TKSQKKRFEEELNERIIRTIDGINSQKQWLKSEDIQRISLFFHNK 633

  Fly   993 VLERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVF-QSSLLTLALSTGALLLLGFLVFLVACHK 1056
            .||::|.:........|..|:.|:.....|::::|. ::::|.::.....|||...|....|.|.
Zfish   634 ALEKEYRATTLPAFKYYVTCACLIFFCIFIVQVLVLPKTTVLEVSFGMAFLLLALILCICFAGHI 698

  Fly  1057 INF---------QLPSDIKRFSLRIHSNRR-ISQLFAFASVALIVLTTLLAMFQESGRQMELLQR 1111
            :.:         :|||     |.::.:|:. |......|:.|||::..:..||.....:|     
Zfish   699 LQWGKAASCTMPRLPS-----SSKVITNKPWIRLALTMATTALILVMAVFNMFFLGEDRM----- 753

  Fly  1112 RRFWLDVNGSISLNDTELNTKMYDAEEP--------DCDFYLAYNTFLLLTLLSMMSCATYQVLR 1168
                        :..|.||......:.|        :..|||.|  |:...:|.::||:.:..:.
Zfish   754 ------------VASTSLNISNSSMDGPYGQITNSSNNKFYLPY--FIYSCILGLISCSVFLRIN 804

  Fly  1169 ILLKLLLLLLASGSY-------MACSSNLYSRSREMSQELANEEALLRYI--IDSIFLFAFMLAL 1224
            ..||::::|.|..:|       .|...:.||.:...:|: .:...:|:.:  :.||.||.|.:.|
Zfish   805 YELKMIIMLGAVVAYNIIILQTHASILDDYSMALYKTQQ-PDRPGVLKDLKTMGSISLFIFFVTL 868

  Fly  1225 IFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQ 1289
            :..:.|.|...||||:|:.:..:|.|::|.::..||.||||:||.|||||||.|....:||||:.
Zfish   869 LVLARQNEYYCRLDFLWRNKFKKECEEIETMENLNRVLLENVLPAHVAEHFLGRNWKNEDLYHQS 933

  Fly  1290 CDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMA 1354
            .|:||::|||||:|.|||.|.:.|.||:||||||||||||||||||:.:|..:||||:.|:||||
Zfish   934 YDTVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMA 998

  Fly  1355 ASGLT-------ANTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVI 1412
            |:||.       |...|| .:.|:..|.::|..|..|::.:|.||||:||||:|||.|||:||||
Zfish   999 ATGLNVTPGLEYAQYHDR-QYMHIGTMVEFAFALVGKLDVINKHSFNDFRMRVGINHGPVIAGVI 1062

  Fly  1413 GACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFL 1477
            ||.|||||||||.|||||||:|||::..||||:|...||:..|:..:|||.::|||||.:.|:|:
Zfish  1063 GAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETNWILQTLGYMCSCRGIINVKGKGDLRTFFV 1127

  Fly  1478  1477
            Zfish  1128  1127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 65/244 (27%)
CYCc 686..881 CDD:214485 122/204 (60%)
Guanylate_cyc 722..895 CDD:278633 110/173 (64%)
DUF1053 <949..1005 CDD:283888 16/58 (28%)
CYCc 1259..1455 CDD:214485 122/203 (60%)
Guanylate_cyc 1285..1479 CDD:278633 116/201 (58%)
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831 65/246 (26%)
CYCc 283..486 CDD:214485 121/203 (60%)
Guanylate_cyc 328..512 CDD:278633 116/189 (61%)
DUF1053 542..646 CDD:283888 21/109 (19%)
CYCc 899..1106 CDD:214485 123/208 (59%)
Guanylate_cyc 929..1128 CDD:278633 116/201 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.