DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and Adcy1

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_033752.1 Gene:Adcy1 MGIID:99677 Length:1118 Species:Mus musculus

Alignment Length:1038 Identity:417/1039 (40%)
Similarity:577/1039 (56%) Gaps:173/1039 (17%)


  Fly   517 LMQVDESVLVFLIVMLICGIVYAFLLC--ILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQP 579
            |.||.:..|.|       .:.:|.|.|  .|..||.:                    :...||..
Mouse   118 LQQVGQLALFF-------SLTFALLCCPFALGGPARS--------------------SAGGAMGS 155

  Fly   580 SKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCT 644
            :.:..|....:::.:::|.:||:|...|:..|::::..||.....|...:...:    |..|...
Mouse   156 TVAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTAALVPAKRPRL----WRTLGAN 216

  Fly   645 LVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDD 709
            .:.....|:.||:.....|::|||||::.|.|||.|||.:.||::|||||:|:|||:||||||:|
Mouse   217 ALLFFGVNMYGVFVRILTERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKED 281

  Fly   710 IAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLR 774
            .. :|.:..|||||||||:|||||||||.|||.|:.||||:|||:||||||.:||.||.|:||.|
Mouse   282 FL-KPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRR 345

  Fly   775 IKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGL 839
            ||:|||||||||||.:|:.|||||.|||||||||.|..|.|...|::|||||:|||||.||||||
Mouse   346 IKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGL 410

  Fly   840 VKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLI 904
            .|||:|||||||||||.||:.|:||:|||||.||.||:||||||.|.|:|||::|:.|.|||:.|
Mouse   411 RKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTFLRTHNIETFFI 475

  Fly   905 VP------------GDIYRPHKKSRNR---------LQVNGNISKELRMMGHGTAQKHTSKFGFG 948
            ||            .|| :|.|:.:.:         :........|:......|.:....:....
Mouse   476 VPSHRRKIFPGLILSDI-KPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR 539

  Fly   949 DSSESAKD------------PEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASE 1001
            .:||..::            |...||.|:.|.::||..: |.........|.:|....|:||...
Mouse   540 TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTE-LEMADLNFFTLKYKHVEREQKYHQL 603

  Fly  1002 PDRMLCVYFYCS-LLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGF-LVFLVACHKINFQLPSD 1064
            .|.    ||..: :|.|:..::..|:.    ||.:..|...||||.| :.|||||          
Mouse   604 QDE----YFTSAVVLALILAALFGLIY----LLVIPQSVAVLLLLVFSICFLVAC---------- 650

  Fly  1065 IKRFSLRIHSNRRISQLFAFASVALIVLTTLLAMF----------------------QESGRQME 1107
                :|.:|    |:::..|.....|.:.|.|.:|                      .:|...:.
Mouse   651 ----TLYLH----ITRVQCFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCLPWAWSSQSNSSLV 707

  Fly  1108 LLQR--RRFWLDVNGSISLNDTELNTKMYDAEEPDCDFYLAYNTFLLLTLLSMMSCATYQVLRIL 1170
            :|..  ||..|                      |......|::. ||..|:..:..|.:..:..|
Mouse   708 VLAAGGRRTVL----------------------PALPCESAHHA-LLCCLVGTLPLAIFLRVSSL 749

  Fly  1171 LKLLLL----------LLASGSYMACSSNLYSRSREMSQELANEEALLRYIIDSIFLFAFMLALI 1225
            .|::||          |..||........|..||.|.              |.:|.||:..||| 
Mouse   750 PKMILLSGLTTSYILVLELSGYTKVGGGALSGRSYEP--------------IMAILLFSCTLAL- 799

  Fly  1226 FHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQC 1290
             |:.|.:...|||::|..||.||::|||.::..|:::|.|:||.|||:|||.......|||::..
Mouse   800 -HARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSY 863

  Fly  1291 DSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAA 1355
            ..|.::|||||||::||:||:|||.||||||||||||||||||:.::.::.:||||:.|:|||||
Mouse   864 SQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAA 928

  Fly  1356 SGL--TANTCDRVNF-SHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKP 1417
            .||  ||.|..:.:. ||:..:||:|:.:||.::|:|..|:|:|.:|:|||:||||||||||.:|
Mouse   929 VGLAPTAGTRAKKSISSHLCTLADFAIDMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRP 993

  Fly  1418 QYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFLKGR 1480
            |||||||.|||||||||||:...||||:|:.::|:...::..|||.|.|||||.|:||||:||
Mouse   994 QYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGR 1056

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 58/199 (29%)
CYCc 686..881 CDD:214485 141/195 (72%)
Guanylate_cyc 722..895 CDD:278633 128/173 (74%)
DUF1053 <949..1005 CDD:283888 16/68 (24%)
CYCc 1259..1455 CDD:214485 113/199 (57%)
Guanylate_cyc 1285..1479 CDD:278633 115/197 (58%)
Adcy1NP_033752.1 AC_N <158..291 CDD:292831 48/138 (35%)
CYCc 257..452 CDD:214485 141/196 (72%)
Guanylate_cyc 293..475 CDD:278633 132/182 (73%)
Interaction with calmodulin. {ECO:0000250} 492..519 3/28 (11%)
CYCc 825..1036 CDD:214485 115/211 (55%)
Guanylate_cyc 858..1055 CDD:278633 115/197 (58%)
Interaction with calmodulin. {ECO:0000250} 1023..1046 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.