DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and Ac76E

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster

Alignment Length:1458 Identity:422/1459 (29%)
Similarity:627/1459 (43%) Gaps:441/1459 (30%)


  Fly   315 ATVGNLTTATMKPPTLASSDQMTRGSSIPLLALASNGSWAGNGAVGGELKSAHNHNIADFEADHN 379
            |..||.|.||..  .:..:|    |::....|:.|:.:         .:..|.:.::||.....|
  Fly     9 AKTGNGTNATAN--LIVKAD----GNATQPKAMTSSAA---------RMNDALSASLADLSEQEN 58

  Fly   380 GQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRMREKRSLQDAGLVKGGGIQTQLIVDTATDDD 444
            |...    :..|...|:             ||||.|.::||..:||:      |.|:        
  Fly    59 GTTA----EDIHLNDLY-------------TRYRQRLRKSLFRSGLL------TSLL-------- 92

  Fly   445 ADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGY 509
            |.|.::.                                            .|:.         |
  Fly    93 ACVVSII--------------------------------------------IGIV---------Y 104

  Fly   510 GQ-LIPLILMQVDESVLVFLIVMLICGIVYAFLL--CILSKPAMNEIFLVLVSYVILGTFLAI-- 569
            || |:..:|:         ::..||.|.:...|.  .:||.||....|.::.:: .|||..||  
  Fly   105 GQHLVQTMLL---------VLAALISGSILTALQFPAVLSSPAAALAFAIVTTF-SLGTIAAITG 159

  Fly   570 -EVA--VSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDE 631
             |:|  ..||:         ..||      ::|||:....:::..:.::.:|:  ..|:....|.
  Fly   160 DELAPLPMYAL---------FLCI------HSMLPISWPVSVVLALFMTAIHI--VYRIGTSPDY 207

  Fly   632 A--VEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLL 694
            |  :.|:..|     :|.|..|:::|:|.....:.|..:....||..||.|::.:.|.:|||:||
  Fly   208 APNLPMLFGE-----IVMLASASVSGLYYRIMSDAAHNRTVDGTRTGIEQRVKLECEREQQEQLL 267

  Fly   695 LSVLPRHVAMEMKDDIAGQPRD-------------TQFHKIYIQRHENVSILFADICGFTSLSDQ 746
            |||:|.::|.|:|..|..:..|             |:||::::|||.||:||||||..||.||..
  Fly   268 LSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSS 332

  Fly   747 CTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIA 811
            .||.:||:.||:||.|||::|.|:.|||||:||||||||||||..||.||...|.|||.|||||.
  Fly   333 LTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIR 397

  Fly   812 LVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCL 876
            .|||...:||:||:|||||.|.||||||.||||||||:||||||||||||:.|||||||:||..|
  Fly   398 HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFL 462

  Fly   877 DGDYEVEVGKGNERNSYLKDHQIETYLIVP----------------------------------- 906
            ...:|||.|:|..|::||.||::|:|||||                                   
  Fly   463 GDKFEVEQGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKEIKETD 527

  Fly   907 --------GDIYRP--------------------------------------------------- 912
                    .|:..|                                                   
  Fly   528 QSHEATDVADVLLPVTVAPPPAIVDEKMSPTSINSQEAPLHAPLASAASMSIKELSEEEDEADEA 592

  Fly   913 --------HK----KSRNRLQVNG------------NISKE----------LRMMG------HGT 937
                    |:    |:....:.||            :::|.          |.|.|      :..
  Fly   593 TAVTEPLMHRDQDGKNDKEPKANGGHRGSGDSAASESVAKSAALSLPADDLLSMSGSESGISNSG 657

  Fly   938 AQKHTSK--------------------------------------FGFGD--------------- 949
            ||..:|.                                      ..|.|               
  Fly   658 AQAQSSNPASVTPTAAAPAGGAASNSLTVAEAPERSRRKLSVQGLMSFADRRRSSGAFIEGRKLS 722

  Fly   950 --SSESAKD---------PEDEVNEY-----------------LMRAIDARSIDHLRAEHCQSLL 986
              |.||.:.         |..::.:|                 |::.|...||..:.:.......
  Fly   723 IHSGESFRSHAGHVTRNRPSSKMTKYVECWGADRPFANIAESKLVKNIGLASIAMIESNLLPPER 787

  Fly   987 LCFKDNVL------------------ERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLL 1033
            .||..|..                  |..|.::||........|:.::.|..::::|:|.:.:|.
  Fly   788 KCFNFNFFGPPTELKPFTMWYRNTPREAMYRAQPDTHFRFDLICAFVLFLSLAVVQLIVIELNLA 852

  Fly  1034 TLALSTGALLLLGFLVFLVACHKINFQLPSDIKRFSLRIHSNRRISQLFAFASVALIVLTTLL-- 1096
            .|     ..||..|:...:..:..|..:| |:...:...:...::.....:..:|:.|:..:|  
  Fly   853 LL-----GSLLASFVSLALFLYLSNMSVP-DVHASTTERNGPGQVVASSRYLRLAMFVVVNILIS 911

  Fly  1097 --AMF------------QESGRQMELLQRRRFWLDVNGSISLNDTELNTKMYDAEEPDCDFYLAY 1147
              |:|            :|......:|:.           :.:...:|:.:.|.:..:.|:.:..
  Fly   912 SCAVFSVINYTVPDGVSKEPSSNQTILES-----------NFSSVFVNSTLEDVQLWEIDYAIPI 965

  Fly  1148 -NTFLLLTLLSMMSCATYQVLRILLKLLLLLLASGSYMACSSNLYSRSREMSQELANEEALLRYI 1211
             ..||....:|:.:.:.:.....:|||:.:|:|..:.:....  ||...||..: ||....|...
  Fly   966 APVFLYCCAISLAAISAFLRSGFILKLIAMLVAVIAQVTVLG--YSDLFEMYND-ANITHGLPLE 1027

  Fly  1212 IDSIFLFAFMLALIFHS--HQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEH 1274
            |.. ||...::.|:.|:  .|.|...|.||:||.:...|:|::|.::..|:.|||||||.|||.|
  Fly  1028 IKG-FLLLLVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMRGINKILLENILPAHVATH 1091

  Fly  1275 FLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERF 1339
            ||..|:. .:||||....|.::||||||:.|||.|.:.|.:|:||||||||||.|||:||.:.:|
  Fly  1092 FLHLERS-TELYHESYSCVAVMFASIPNYKEFYDETDVNKQGLECLRLLNEIICDFDKLLLKPKF 1155

  Fly  1340 RCIEKIKSTGATYMAASGLTANTCD-----------RVNFSHVTAMADYALQLFDKIEEVNMHSF 1393
            ..|||||:..:|||.||||.....|           |....:|..:.::|:.|...::.:|..||
  Fly  1156 SGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEKRTEEHNVVILVEFAIALMSILDSINRESF 1220

  Fly  1394 NNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFEL 1458
            ..||:|||:|.|||:||||||.|||||||.|.|||||||||.|::..:|.|:...:||...|:|.
  Fly  1221 QRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSCGVMGRLQTTENTAKILMTAGYEC 1285

  Fly  1459 TCRGSVDVKGKGSMITYFLKGRRPIDAK 1486
            .|||...|||||:::|||:|  .|.|.|
  Fly  1286 ECRGLTYVKGKGNLVTYFVK--TPFDGK 1311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 57/219 (26%)
CYCc 686..881 CDD:214485 125/208 (60%)
Guanylate_cyc 722..895 CDD:278633 115/173 (66%)
DUF1053 <949..1005 CDD:283888 17/117 (15%)
CYCc 1259..1455 CDD:214485 105/207 (51%)
Guanylate_cyc 1285..1479 CDD:278633 104/205 (51%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 74/334 (22%)
CYCc 259..467 CDD:214485 125/208 (60%)
Guanylate_cyc 311..469 CDD:278633 109/158 (69%)
BASP1 510..667 CDD:283191 13/157 (8%)
CYCc 1079..1283 CDD:214485 105/205 (51%)
Guanylate_cyc 1101..1305 CDD:278633 103/204 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111942941
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.