DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and ACXD

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster

Alignment Length:1184 Identity:330/1185 (28%)
Similarity:517/1185 (44%) Gaps:300/1185 (25%)


  Fly   526 VFLIVMLICGIVYAFLLCILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQPSKSFNG----- 585
            :|:.:.:...:::..||  |:.|.:..:::.:|:|:..|..:.:.:.|::..: ..|.:|     
  Fly    67 LFIFIHVAVTVIHTLLL--LTTPEIKYVYVDMVAYMCSGLVIWVVLGVNFRSE-LVSKHGWVVYA 128

  Fly   586 ----SACCIVL-------------------IYMTYTM--------LPLRLREALIGGILLSVVHL 619
                :.|.:||                   ||..||:        :|..|:..::|..:.....:
  Fly   129 TSWLAVCVMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYII 193

  Fly   620 YTCLRLNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQ 684
            .....:.|..|..:..|     |...:.|...||.|::....::.|.|..|::.||.:|..|..:
  Fly   194 NYSFVITAKDDNQMHSI-----LNEAIYLSCVNLLGIFFRLMRDIALRTTFLDRRQYVEENLLLR 253

  Fly   685 RENQQQERLLLSVLPRHVAMEMKDDIAGQ-PRDTQFHK--------------------------I 722
            ....|:..||||:||..:|..:::|:..: .|..|.|:                          :
  Fly   254 YARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTL 318

  Fly   723 YIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSG 787
            :|:.||:|::|:||:..:|.|:.....::||..|::||.|||..:.|::.||||.||||||||:|
  Fly   319 FIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAG 383

  Fly   788 LPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVT 852
            |..|..|||.|.|::||.||..|..|||...:|::||:|:|:|.|..||:|..|||||:||.||.
  Fly   384 LANPNADHAKCCVDLGLRMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVD 448

  Fly   853 LANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNER-NSYLKDHQIETYLI--VPGDIYRPHK 914
            :||.:|:.|..||||::::||..|||:|..|.|....| :..|:.|.|.|:||  :...::.|.:
  Fly   449 IANRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFLIKSLRAPMHDPRR 513

  Fly   915 KSRNRL--------------------------QVNGNISKELRMMGHGTAQKHTSKFGFGDSSES 953
            :.|.|.                          |....:.:||..|..|..|. |..|     ..|
  Fly   514 RMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLEMCRELDKMPIGRIQL-TKVF-----RRS 572

  Fly   954 AKDPEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASEPDRMLCVYFYCSLLVLL 1018
            .:..:||:.|...|    |:|        .|..|.|:....|.:|..|||            |:|
  Fly   573 TRLTQDEIEEETFR----RNI--------SSCCLFFRIRNWEFQYIKEPD------------VML 613

  Fly  1019 GTSIMRLVVFQSSLLTLALST-----------GALLLLGFLVFLVACHK---INFQLPSDIKRFS 1069
            ..||....|....|||:.|.:           |..::|..::.:|:.:|   |.:...:|:.   
  Fly   614 KYSIALAWVIYMGLLTIQLLSKDARYHYWYIDGTTIILLTMLLIVSWYKKLWIMYMSDADVS--- 675

  Fly  1070 LRIHSNRRISQ-LFAFA-----SVALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSISLNDTE 1128
               ..|.|:|. ||..:     :|.:.|:...|.:|  |...:.::|       |.|..|..|..
  Fly   676 ---SPNGRLSGFLFRMSDEMQRNVVIRVVMYFLIIF--SYCAVAIMQ-------VVGCSSDEDYA 728

  Fly  1129 LNTKMYDAEEPDCDFYLAYNTFLL---LTLLSMMSCATYQVLRILLKLLLLLLASGSYMACSSN- 1189
            .....|| |...|     ::.::|   :||:..||....::..|:......|:..|..:...|. 
  Fly   729 DLDPTYD-ERVQC-----FHPWILTNCMTLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVVSEF 787

  Fly  1190 --LYSRSREMSQELANEEALLRYIIDSIFLFAFMLALIFH--SHQTEATYRLDFIWKLQATEEKE 1250
              :|:.|...:   .|..|...:|:..|..|.     |||  ..|||...::|:.||.|..:::|
  Fly   788 NFIYANSPSTN---VNFNAKYSHILLMIITFG-----IFHLMERQTEFIAKVDYNWKRQLIKKQE 844

  Fly  1251 DMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNE 1315
            |........:.||.||||.|||:.:||.:.. ::||:|:.|:|.::||||.||....:.      
  Fly   845 DALITNDTIKVLLTNILPTHVADFYLSNQLQ-NELYYEEYDNVAVMFASIKNFDTDKIG------ 902

  Fly  1316 GVECLRLLNEIIADFDELLSE--ERFRCIEKIKSTGATYMAASGLTANTCDRVN-----FSHVT- 1372
                ||:|||||.|||::|::  :..| :||||....|||||.||..:..::||     |.:|: 
  Fly   903 ----LRVLNEIICDFDDVLNKYSQSLR-VEKIKVANWTYMAACGLDVSRSEQVNAPQMKFRNVSL 962

  Fly  1373 ----------------------------------------------------------------- 1372
                                                                             
  Fly   963 MPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDLERGQYEGNVITSGPRISSTHNGSSSNEV 1027

  Fly  1373 --AMADYALQLFDKIEEVNMHSFNNFRM-------------RIGINIGPVVAGVIGACKPQYDIW 1422
              .||::||.|..     .|..||...|             ||||:.|..:|||:|..||.||||
  Fly  1028 VRVMAEFALDLMR-----TMRRFNTENMQTEYEGSTDYGMLRIGISHGRAMAGVVGISKPHYDIW 1087

  Fly  1423 GNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTC--RGSVDVKGKGSMITYFLKGRRPIDA 1485
            ||.||:||||||||:...||||:  ...|:.|.|.:.|  ||...|||:|::.||.:    .||:
  Fly  1088 GNPVNMASRMDSTGVPGQIQVTE--NTALKLREFNIQCNYRGMTFVKGRGNIPTYII----GIDS 1146

  Fly  1486 KELELAKTEVEPPK 1499
            :...|......|.|
  Fly  1147 EYQFLPHRPAAPTK 1160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 47/231 (20%)
CYCc 686..881 CDD:214485 91/222 (41%)
Guanylate_cyc 722..895 CDD:278633 83/174 (48%)
DUF1053 <949..1005 CDD:283888 15/56 (27%)
CYCc 1259..1455 CDD:214485 91/284 (32%)
Guanylate_cyc 1285..1479 CDD:278633 90/284 (32%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831 45/225 (20%)
CYCc 254..476 CDD:214485 90/222 (41%)
Nucleotidyl_cyc_III 321..503 CDD:299850 87/182 (48%)
CYCc 856..1117 CDD:214485 90/280 (32%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 90/282 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110126725
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.