DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and rut

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster

Alignment Length:1646 Identity:519/1647 (32%)
Similarity:760/1647 (46%) Gaps:444/1647 (27%)


  Fly   528 LIVMLICGIV---------YAFLL-----CILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQ 578
            ::|:|.|.::         |..||     |::|.|.:..:|.|....|:.               
  Fly    81 VLVLLQCSVIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMA--------------- 130

  Fly   579 PSKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLC 643
                 .|....:.::::.|.|:||::.||:..||.|..||:  .|.:..:..:|:..:.:.:|:.
  Fly   131 -----EGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHI--SLTVYKIFTDALRYLEYNQLIA 188

  Fly   644 TLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKD 708
            .:|..:..|:.|:..:...|:|||:.|::||.||.:||..|.||::.|||||||||:||||:||:
  Fly   189 NIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKN 253

  Fly   709 DIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCL 773
            ||. .|...|||:||||:|||||||||||.|||.||.||:|:||||||||||.|||:||.::|||
  Fly   254 DIL-SPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCL 317

  Fly   774 RIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLG 838
            |||:|||||||||||||||.|||.||||||||||||||.|.|...|.:|||||||||||.|||||
  Fly   318 RIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLG 382

  Fly   839 LVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYL 903
            |.|||||||||||||||||||||.|||||:|:.||..|.|:||||.|.|:||:|||:||.::|:.
  Fly   383 LRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAGHGDERSSYLRDHGVDTFF 447

  Fly   904 IVPGDIYRPHKK---------------SRNRLQV------------------------------- 922
            |||    .||::               ||.:|..                               
  Fly   448 IVP----PPHRRKPLMLNTLGVRSAIGSRRKLSFRNVSNVVMQLLHTIKFSEPVPFSNIATGSFP 508

  Fly   923 --------------------------------NGNIS-------KELRM------------MGHG 936
                                            :||:.       |.:|:            ||:|
  Fly   509 SAASALGGGVSVGGGGGGGGGGVARGSTCEANSGNVQVSEKGSRKVIRLQKILHATPPPHGMGYG 573

  Fly   937 TA----------------------------------------------QKHTSKFGFGDSSESAK 955
            :.                                              .:|..|.....|..:.|
  Fly   574 SVVGSGGGVDSGISGGGGCVSGGIAGGGGVQVTVGTNPNSTASTISRIHRHNHKNNKSQSKVADK 638

  Fly   956 ---------------DPEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASEPDRM 1005
                           .|.:.||.:|.:||:|||:|..::||...|.|.|:.:.:||:|..:.|..
  Fly   639 FKRPFRKRHSVAAHHQPTNRVNRFLSQAINARSVDCDKSEHVDRLTLRFRQSDMEREYHKDFDLG 703

  Fly  1006 LCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIKRFSL 1070
            ......||||:|:..:.:::.....:|:.|.|...|.:.:..::.|:...::.:.:....:.|||
  Fly   704 FTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSL 768

  Fly  1071 RIHSNRRISQLFAFASVALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSISL-NDTELNTKMY 1134
            |:...  |..:....||..:.:.|.::....||               ||:.|. ||:.....: 
  Fly   769 RMAIT--IFTVILIYSVGQVNVFTCVSDHPCSG---------------NGTTSFQNDSHRKCSL- 815

  Fly  1135 DAEEPDCDFYLAYNTFLLLTLLSMMSCATYQVLRILLKLLLLL-----------LASGSYMACSS 1188
                |.   |::     |....:.:|.:.:..|.|:.|.||:|           |:..:...|..
  Fly   816 ----PQ---YVS-----LSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYD 868

  Fly  1189 NLYSRSREMSQELANEEALLRYIIDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEKEDME 1253
            |..:.|..:            ::|....:..||:|::.|....|.|.||||:|:|||::||::|:
  Fly   869 NRVNASIPL------------HLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEKKEMD 921

  Fly  1254 HLQAYNRKLLENILPVHVAEHFLSRE-KHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGV 1317
            .||..|:::|.|:||.|||.|||..: ::..:|||:....|.::|||:|||:|||.|::|:::|:
  Fly   922 VLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGL 986

  Fly  1318 ECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGL---------TANTCDRVNFSHVTA 1373
            |||||||||||||||||.|:|||.|:|||:.|:||||..||         ..|:..|    |:||
  Fly   987 ECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRR----HMTA 1047

  Fly  1374 MADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLV 1438
            :.:|...:...::|:|.||:|||.:|:||||||||||||||.|||||||||.|||||||||||:.
  Fly  1048 LIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVP 1112

  Fly  1439 DHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFL--KGRRPIDAK---ELELAKTEVEPP 1498
            .:.|||||:...|.|..||..|||::.|||||.|:||||  .|.:.::.:   .:.|.::...|.
  Fly  1113 GYSQVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTYFLCDSGNKSLNGEVRNAMSLPQSLHAPD 1177

  Fly  1499 KTLTLAKEPE-KLDSGTATEK-----------QREQVKEQGSTEQEDDL-LPSPDIDMNSNMQNL 1550
            ..:.:::.|| ::::.|.::|           :.:|:..|...:|.|.| ||:|...::.::...
  Fly  1178 YYMKVSQFPENRVNTDTYSKKENGHLYAGNGVEEQQLLLQHQHKQHDPLPLPAPPPPVHHHLHQQ 1242

  Fly  1551 TAQRRKSLCRQHNISSSFGTTVSSSTGITPSISNSSSVVTIGALPAILRGGN----------PLS 1605
            ..||..|..::..|                       .:..|.||.|...||          ...
  Fly  1243 QQQRLNSKLQKQPI-----------------------FMANGGLPNIRENGNGHNGEHQQQQQQQ 1284

  Fly  1606 NANPNATDSCSECGGASKSLATPTAP----------------------PRTLVADLKDEIARDEK 1648
            ..:........:.||...:..||.|.                      |..:...::.:|....:
  Fly  1285 QQHQQQQQQQQQHGGFMVATTTPPAAVAVPLQPQHHQLQFQHPHQHPLPSAVSVPVQHQILLHHQ 1349

  Fly  1649 IGLK------------DSIEN---------LEILLKNNISLSDLSNKQQQNLRGETSSSTTTTLR 1692
            :.|:            :.|||         :|.|..::.|| |||. ....:......|....:.
  Fly  1350 LQLQHQPVPSVMLREFNIIENPTSGGRHQQMEQLPPHHGSL-DLSG-MGMGVGAGVLGSDCFMMP 1412

  Fly  1693 KRDTIVSF-----------------NVTETVTTTAAPFTS-SSGSSNSSSQQKKRRSVTTIA--- 1736
            :||...::                 |:....:.....||| ..|....|.......||..:|   
  Fly  1413 RRDRERTYVPPLNQHGHHPPHHLHSNLNLNQSQHPPSFTSLGYGQCRESEPLLHASSVAPVAKIM 1477

  Fly  1737 ----------ASFTTSTTTRLLSNESQSSTQTAPGTLESGGSVPGQSSTENSSQDWQPRTA---- 1787
                      ..:|:..|  :||.:.|...|.         ....|.....|:||.|...|    
  Fly  1478 PMQHAPKYEPPRYTSPHT--MLSQQHQQQQQQ---------QHQHQQPQSQSAQDQQTHPAQDPH 1531

  Fly  1788 ---------SLEPNRSP-----------------IKTSQSMSPIGQLTTEVFVLPNSRSMVLISS 1826
                     |.:|...|                 ::.|:.||....|::.    |:|.||   ||
  Fly  1532 PLQRQYAMYSQQPQLPPKPVLRTYMKPLPKLPTDLEESRDMSSTDDLSSR----PHSPSM---SS 1589

  Fly  1827 TNGSVSAL--ATGGGGASSPR 1845
            ::.|.|..  ..|.|...|||
  Fly  1590 SDESYSKTTEGEGEGDEDSPR 1610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 64/206 (31%)
CYCc 686..881 CDD:214485 151/195 (77%)
Guanylate_cyc 722..895 CDD:278633 138/173 (80%)
DUF1053 <949..1005 CDD:283888 21/71 (30%)
CYCc 1259..1455 CDD:214485 114/206 (55%)
Guanylate_cyc 1285..1479 CDD:278633 118/205 (58%)
rutNP_511156.2 AC_N <17..255 CDD:292831 60/196 (31%)
CYCc 230..425 CDD:214485 151/196 (77%)
Guanylate_cyc 266..438 CDD:278633 137/172 (80%)
DUF1053 624..696 CDD:283888 21/72 (29%)
SLC5-6-like_sbd <742..>893 CDD:294310 34/193 (18%)
CYCc 924..1134 CDD:214485 117/214 (55%)
Guanylate_cyc 954..1151 CDD:278633 117/201 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 605 1.000 Inparanoid score I499
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D46761at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.