DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and Adcy8

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_058838.1 Gene:Adcy8 RGDID:2036 Length:1248 Species:Rattus norvegicus

Alignment Length:1334 Identity:482/1335 (36%)
Similarity:689/1335 (52%) Gaps:268/1335 (20%)


  Fly   335 QMTRGSSIPLLALAS------------------NGSWAGNGAVGGELKSAHNHNIADFEADH--N 379
            |::..|.:||.:|.|                  :||.:|:|. ||:|...| .:.|...:|.  |
  Rat    79 QLSSDSVLPLYSLGSGERAHNTGGTKVFPERSGSGSASGSGG-GGDLGFLH-LDCAPSNSDFFLN 141

  Fly   380 GQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRMREKRSLQDAGLVKGGGIQTQLIVDTATDDD 444
            |...:|.......|...|.|...:.:|    ||.:.::|             :::::::.     
  Rat   142 GGYSYRGVIFPTLRNSFKSRDLERLYQ----RYFLGQRR-------------KSEVVMNV----- 184

  Fly   445 ADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGY 509
            .||.|                  .:|..                ||:.|    :|:...||..|.
  Rat   185 LDVLT------------------KLTLL----------------VLHLS----LASAPMDPLKGI 211

  Fly   510 GQLIPLILMQVDESVLVFL--IVMLICGIVYAFLLCILSKPAMNEIFLV---LVSYVILGTFLAI 569
                          :|.|.  |.::||.:|      ::.|...:..:|.   :|::|.:.|.: :
  Rat   212 --------------LLGFFTGIEVVICALV------VVRKDTTSHTYLQYSGVVTWVAMTTQI-L 255

  Fly   570 EVAVSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALIGGI---LLSVVHLYTCLRLNAMQDE 631
            ...:.|.:..    :|....:..::.||:||||.|..|::.|:   ||.|.......||      
  Rat   256 AAGLGYGLLG----DGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLLQVTLQVLIPRL------ 310

  Fly   632 AVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLS 696
            ||..|:  ::|..:|..:..|..|::..:..::|||:||:|||:|:|||||.:.|||:||||:||
  Rat   311 AVFSIN--QVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLS 373

  Fly   697 VLPRHVAMEMKDD---IAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNE 758
            ||||.|.:||.:|   :..:....|||:|||.|:|||||||||:.|||:||...:|:||||:|||
  Rat   374 VLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNE 438

  Fly   759 LFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNM 823
            |||||||||.||||||||:|||||||||||||||.|||||.|||||.||..|..||.....:|:|
  Rat   439 LFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRFVRSRTKHDVDM 503

  Fly   824 RVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGN 888
            |:|||:|.|.||||||.||||||||.||.:||.:||||||||:||:|.||.||.|||.||.|.|.
  Rat   504 RIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLSGDYNVEEGHGK 568

  Fly   889 ERNSYLKDHQIETYLI---------VPGDIYRPHKKSRNRLQ-----VNGNISKEL--------- 930
            |||.:|:.|.||||||         :|.||.:......:|..     ..|:.|.||         
  Rat   569 ERNEFLRKHNIETYLIKQPEESLLSLPEDIVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQ 633

  Fly   931 -----------RMMGHGTAQKHTSKFGFGDSSESAKDPEDEVNEYLMRAIDARSIDHLRAEHCQS 984
                       .::.:..||....:.|          || |:|:.:...||.||.|.||.||.:.
  Rat   634 NTLAALTRNSINLLPNHLAQALHVQSG----------PE-EINKRIEHTIDLRSGDKLRREHIKP 687

  Fly   985 LLLCFKDNVLERKYASEPDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLV 1049
            ..|.|||:.||.||:...|.:......|:.:|||..:.::.::..|.|:.:.:....|::|...:
  Rat   688 FSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSAL 752

  Fly  1050 FLVACHKINFQLPSDIKRFSLRIHSNRRISQLFAFASVALIVLTTLLAMFQESGRQMELLQRRRF 1114
            .|:...:....||..:::....|:.......:..|||:.:..|          |..:.:|     
  Rat   753 VLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFL----------GAVINIL----- 802

  Fly  1115 WLDVNGSISLNDTELNTKMYDAEEPDCDFYLAYNTFLLLTLLSMMSCATYQVLRILLKLLLLLLA 1179
            |.|.:.||.|.:...|:   .|...|...|..|  |:...:|:|::||.:..|..:|||.:||:.
  Rat   803 WCDFDKSIPLKNLTFNS---SAVFTDICSYPEY--FVFTGVLAMVTCAVFLRLNSVLKLAVLLIM 862

  Fly  1180 SGSYMACSSNLY--------SRSREMSQELANEEALLRYIIDSIFLFA-FMLALIFHSHQTEATY 1235
            ...|...:..:|        :.:......|..:||       |:.|.| |:||:.:|..|.|.|.
  Rat   863 IAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEA-------SLLLMAMFLLAVFYHGQQLEYTA 920

  Fly  1236 RLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASI 1300
            ||||:|::||.||..:|:.|:.:|..:|.||||.|||.|||.:::..::||.:..|:|.::||||
  Rat   921 RLDFLWRVQAKEEINEMKDLREHNENMLRNILPGHVARHFLEKDRDNEELYSQSYDAVGVMFASI 985

  Fly  1301 PNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLT--ANTC 1363
            |.|::||.:.|.||:|||||||||||||||||||.|:||:.|||||:.|:||||.|||:  ...|
  Rat   986 PGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQC 1050

  Fly  1364 DRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNV 1428
            :. .:.|:.|:||::|.|.:.|:|:|.||||||.:||||:.|.||||||||.||||||||..||:
  Rat  1051 ED-KWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNL 1114

  Fly  1429 ASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKG----KGSMITYFLKGR---RPIDAK 1486
            ||||||||:...|||.:|...||:.:||....||.:.|||    :|.:.||||.||   .|.   
  Rat  1115 ASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPF--- 1176

  Fly  1487 ELELAKTEVEPPKTL----TLAKEPEKLDSGTATEKQREQVKEQGSTEQEDDLLPSPDIDMNSNM 1547
                    :.||:.|    :||.....|                                    :
  Rat  1177 --------ILPPRRLPGQYSLAAVVLGL------------------------------------V 1197

  Fly  1548 QNLTAQRRKSLCRQHNISSSFGTTVSSSTGITPS 1581
            |:|..||:|.|..:::.|....:..:..|.:|||
  Rat  1198 QSLNRQRQKQLLNENSNSGIIKSHYNRRTLLTPS 1231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 67/208 (32%)
CYCc 686..881 CDD:214485 137/198 (69%)
Guanylate_cyc 722..895 CDD:278633 125/173 (72%)
DUF1053 <949..1005 CDD:283888 22/56 (39%)
CYCc 1259..1455 CDD:214485 115/198 (58%)
Guanylate_cyc 1285..1479 CDD:278633 115/200 (58%)
Adcy8NP_058838.1 Involved in ORAI1, STIM1, PPP2CA and PPP2R1A interaction. {ECO:0000269|PubMed:16258073, ECO:0000269|PubMed:22494970, ECO:0000269|PubMed:22976297} 1..179 26/119 (22%)
Involved in AKAP5 and PRKAR2A interaction. {ECO:0000269|PubMed:22976297} 1..106 6/27 (22%)
Essential for CALM1 interaction. {ECO:0000269|PubMed:16258073} 38..40
Essential for CALM1 interaction. {ECO:0000269|PubMed:16258073} 49..51
AC_N <158..397 CDD:292831 82/332 (25%)
CYCc 363..561 CDD:214485 137/198 (69%)
Guanylate_cyc 402..586 CDD:278633 132/184 (72%)
DUF1053 614..708 CDD:283888 29/105 (28%)
CYCc 941..1145 CDD:214485 117/205 (57%)
Guanylate_cyc 970..1169 CDD:278633 115/200 (58%)
Involved in CALM1 interaction. {ECO:0000269|PubMed:16258073} 1106..1248 52/174 (30%)
Required for both calcium stimulation and maintenance of autoinhibition. {ECO:0000269|PubMed:19305019} 1197..1212 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.