DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and Adcy6

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001257714.1 Gene:Adcy6 RGDID:2035 Length:1180 Species:Rattus norvegicus

Alignment Length:1464 Identity:564/1465 (38%)
Similarity:748/1465 (51%) Gaps:374/1465 (26%)


  Fly    98 VGGSGSHQASME----LHVPGQEGRGTSSGAGSPQTQTQPSTPKKSNWEVIEHFNTSAKGG---- 154
            |..|||.::||.    |.||..:.|.|:.|..:.|.:     |:::         |.|:|.    
  Rat     5 VARSGSGRSSMSWFSGLLVPKVDERKTAWGERNGQKR-----PRQA---------TRARGFCAPR 55

  Fly   155 -----KAVVSSSLIAAGITRCNIDESMDSTNSSSTCHSPMIYQRDETQLLQPGDA---------- 204
                 |.|...|...|..|||                 |.   :||..:.:.|..          
  Rat    56 YMSCLKNVEPPSPTPAARTRC-----------------PW---QDEAFIRRAGPGRGVELGLRSV 100

  Fly   205 ----SNLEANNPMSSGGGGGTANGPVSPSI------SFWFRLNRIILRLCSTHQFKNLQVEMLYQ 259
                .:.|...||      |||.  |:|..      |.|.||.::.    .:.||::.::|.|||
  Rat   101 ALGFDDTEVTTPM------GTAE--VAPDTSPRSGPSCWHRLAQVF----QSKQFRSAKLERLYQ 153

  Fly   260 RYFLRMNQSNTTHILALLLALILALSCTLLVFTTLQLRRSTSLLLEISEIGLDANATVGNLTTAT 324
            |||.:||||:    |.||:|:::.|...||.|                           :...|.
  Rat   154 RYFFQMNQSS----LTLLMAVLVLLMAVLLTF---------------------------HAAPAL 187

  Fly   325 MKPPTLASSDQMTRGSSIPLLALASNGSWAGNGAVGGELKSAHNHNIADFEADHNGQLVWRRQKR 389
            .:|..:|            ||..||                                        
  Rat   188 PQPAYVA------------LLTCAS---------------------------------------- 200

  Fly   390 KHYRRLHKHRYKHKSHQQHRTRYRMREKRSLQDAGLVKGGGIQTQLIVDTATDDDADVYTVASDD 454
                                                                             
  Rat   201 ----------------------------------------------------------------- 200

  Fly   455 DDDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPLILMQ 519
                                                                             
  Rat   201 ----------------------------------------------------------------- 200

  Fly   520 VDESVLVFLIVMLICGIVYAFLLCILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQPSKSFN 584
                 ::|:::|::|           ::.:..:..:.:||||:||...|::|..:.|..|.....
  Rat   201 -----VLFVVLMVVC-----------NRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSA 249

  Fly   585 GSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCTLVALL 649
            |..|.:..:|:|||:||:|:|.|::.|:.||.:||.....||     ..:...|::|...:|..|
  Rat   250 GLWCPVFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWHLN-----NGDPFLWKQLGANVVLFL 309

  Fly   650 LANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQP 714
            ..|..||.||:|.|.:||:||.|||..|:|||..|.||:|||||||||||:|||||||:||..:.
  Rat   310 CTNAIGVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK 374

  Fly   715 RDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLG 779
            .|..|||||||:|:|||||||||.|||||:.||||:|||..|||||||||:||||:||||||:||
  Rat   375 EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILG 439

  Fly   780 DCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQF 844
            |||||||||||.|.|||||.||||:|||:||:|||||..||||||||||:||||||||||.||||
  Rat   440 DCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQF 504

  Fly   845 DVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDI 909
            ||||||||||||||:||..||:|||:.||:.|:||||||.|:|.|||:|||:..|||:||:....
  Rat   505 DVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQCIETFLILGASQ 569

  Fly   910 YRPHKKSR----NRLQVNG-----------------NISKELRMMGHGTAQKHTSKFGFGDSSES 953
            .|..:|:.    .|.:.|.                 ..||..|.||...:.|...      .::.
  Rat   570 KRKEEKAMLVKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKENR------GAQD 628

  Fly   954 AKDPEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASEPDRMLCVYFYCSLLVLL 1018
            |.:|||||:|:|.|||||||||.||.:|.:..||.|:...||:||:.:.|.....|..|:|||..
  Rat   629 ALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFC 693

  Fly  1019 GTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIKRFSLRIHSNRRISQLFA 1083
            ....::.:||..|.|.|.:..|..|||...|.:.|........|:.::|.|..|..:|..|....
  Rat   694 FICFIQFLVFPHSALILGIYAGIFLLLLVTVLICAVCSCGSFFPNALQRLSRSIVRSRVHSTAVG 758

  Fly  1084 FASVALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSISLNDTELN------TKMYDAEEPDCD 1142
            ..||.|:.::.:..||..|...:.....|...|..:...:.:..:||      ..:.:...|.|.
  Rat   759 VFSVLLVFISAIANMFTCSHTPLRTCAARMLNLTPSDVTACHLRQLNYSLGLEAPLCEGTAPTCS 823

  Fly  1143 F--YLAYNTFLLLTLLSMMSCATYQVLRILLKLL---------LLLLASG-------SY-MACSS 1188
            |  |     |:...|||:::.:.:..:..:.||:         ||||..|       :| :..|.
  Rat   824 FPEY-----FVGSVLLSLLASSVFLHISSIGKLVMTFVLGFIYLLLLLLGPPATIFDNYDLLLSV 883

  Fly  1189 NLYSRSREMSQEL---ANEEALLRYIIDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEKE 1250
            :..:.|.|....|   |.....|:| :..:.|..|.|||..|:.|.|:|.||||:||||||.|||
  Rat   884 HGLASSNETFDGLDCPAVGRVALKY-MTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKE 947

  Fly  1251 DMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNE 1315
            :||.||||||:||.||||..||.|||:||:..|:||::.|:.|.::||||.||||||||||.|||
  Rat   948 EMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNE 1012

  Fly  1316 GVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQ 1380
            |||||||||||||||||::||||||.:||||:.|:||||||||.|:|.|:|..||:||:||||::
  Rat  1013 GVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMR 1077

  Fly  1381 LFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQ 1445
            |.::::.:|.||||||:|:||:|:||||||||||.|||||||||.|||:|||||||:.|.||||.
  Rat  1078 LMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTT 1142

  Fly  1446 EMQQILEGRGFELTCRGSVDVKGKGSMITYFLKG 1479
            ::.|:|..:|::|.|||.|.|||||.|.||||.|
  Rat  1143 DLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNG 1176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 78/197 (40%)
CYCc 686..881 CDD:214485 155/195 (79%)
Guanylate_cyc 722..895 CDD:278633 139/173 (80%)
DUF1053 <949..1005 CDD:283888 28/56 (50%)
CYCc 1259..1455 CDD:214485 133/196 (68%)
Guanylate_cyc 1285..1479 CDD:278633 133/194 (69%)
Adcy6NP_001257714.1 AC_N 28..380 CDD:292831 137/632 (22%)
CYCc 346..541 CDD:214485 155/195 (79%)
Guanylate_cyc 382..566 CDD:278633 145/184 (79%)
DUF1053 594..680 CDD:283888 34/92 (37%)
CYCc 956..1157 CDD:214485 135/201 (67%)
Guanylate_cyc 982..1176 CDD:278633 133/194 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 951 1.000 Inparanoid score I311
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 1 1.000 T617441
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.