DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and ADCY4

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 HGNCID:235 Length:1077 Species:Homo sapiens

Alignment Length:1107 Identity:390/1108 (35%)
Similarity:561/1108 (51%) Gaps:209/1108 (19%)


  Fly   511 QLIPLILMQVDESVLVFLIVMLICGIVY----------------AFL---LCIL----------- 545
            |..||:|:         |:.:::|.:..                :||   ||.|           
Human    25 QQYPLLLL---------LLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLLLGLAS 80

  Fly   546 --------SKPAMNEIFLVLV----SYVILGTFLAIEVAVSYAMQPSKSFNGSACCIVLIYMTYT 598
                    ::|....:::.|:    :::..|..::....|||             .:.:|:..|.
Human    81 REQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSY-------------FLFVIFTAYA 132

  Fly   599 MLPLRLREALIGGILLSVVHLYTC-LRLNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPK 662
            ||||.:|:|.:.|:..|:.||... |.|....|....::  .:|....|..|..|:.|||.....
Human   133 MLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALL--PQLAANAVLFLCGNVAGVYHKALM 195

  Fly   663 EKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDI-----AGQ---PRDT-Q 718
            |:|.|..|.|....:.:|.|...|.:.||.||||:||.::|.|||.:|     |||   |..| .
Human   196 ERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNN 260

  Fly   719 FHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYY 783
            ||.:|::||:.||:|:|||.|||.|:.:|:.:|||.:|||||.:||::|.||.|:|||:||||||
Human   261 FHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYY 325

  Fly   784 CVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWS 848
            ||||||...||||...|.|||||..||..:|....|::|||||:|:|.|.|||:||.|||:||||
Human   326 CVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWS 390

  Fly   849 NDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPH 913
            :|||||||||:||:|||||||..||..|.|.|.||......|:.||::....|||::.     |.
Human   391 HDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVID-----PR 450

  Fly   914 KKSRNRLQVNGNISKEL------------RMMGHGTAQKHTSKFGFGDS--SESAKDPEDEVNEY 964
            .:..:.....|.:...|            |.:....|.|..:....|||  |.|...||..:..:
Human   451 AEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASF 515

  Fly   965 -----LMRAIDARSIDH----------------------LRAEHCQSLLLCFKDNVLERKYASEP 1002
                 |.|:...|.:|.                      .:::....|.|.|::..:|::|....
Human   516 STQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSA 580

  Fly  1003 DRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIKR 1067
            ......|..|:.||.|...|::::| .:....||::.....|| ||:.|..|      ...|:.|
Human   581 IPAFKYYEACTFLVFLSNFIIQMLV-TNRPPALAITYSITFLL-FLLILFVC------FSEDLMR 637

  Fly  1068 FSLR----IHSNRRISQLFAFASVALIVL--TTLLAMFQESGRQMELLQRRRFWLDVNGSISLND 1126
            ..|:    :|....:|.|.|......|.|  .|:|.:|..:                        
Human   638 CVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMA------------------------ 678

  Fly  1127 TELNTKMYDAEEPDCDFYLAYNTFLLLTLLS----------------------MMSCATYQVLRI 1169
              :.:..:.....||.|. |.|...:::.||                      .:||:.:..:..
Human   679 --ITSLFFFPTSSDCPFQ-APNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSF 740

  Fly  1170 LLKLLLLLLASGSYMACSSNLYSRSREMSQE----------LANEEALLR--YIIDSIFLFAFML 1222
            .||||||||    ::|.|.:|:..|.....|          |.:...:|:  .::.:|..|.|..
Human   741 ELKLLLLLL----WLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFF 801

  Fly  1223 ALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYH 1287
            .|:..:.|.|...||||:||.:..:|:|:.|.::...|.||||:||.|||..|:.:.:..:||||
Human   802 TLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYH 866

  Fly  1288 EQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATY 1352
            :..:.||:||||:|:|.|||.|...|:||:||||||||||||||||||:.:|..:||||:.|:||
Human   867 QSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTY 931

  Fly  1353 MAASGLTANT-------CDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAG 1410
            |||:||.|.:       .:| :.||:..|.::|:.|..|::.:|.|||||||:|:|:|.||||||
Human   932 MAATGLNATSGQDAQQDAER-SCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAG 995

  Fly  1411 VIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITY 1475
            ||||.|||||||||.|||||||:|||::..||||:|....|:..|:....||.:.|||||.:.||
Human   996 VIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTY 1060

  Fly  1476 FL 1477
            ||
Human  1061 FL 1062

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 62/249 (25%)
CYCc 686..881 CDD:214485 121/204 (59%)
Guanylate_cyc 722..895 CDD:278633 105/173 (61%)
DUF1053 <949..1005 CDD:283888 15/85 (18%)
CYCc 1259..1455 CDD:214485 115/203 (57%)
Guanylate_cyc 1285..1479 CDD:278633 115/201 (57%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831 46/146 (32%)
CYCc 219..422 CDD:214485 120/203 (59%)
Guanylate_cyc 264..418 CDD:278633 97/154 (63%)
DUF1053 479..583 CDD:283888 19/104 (18%)
CYCc 827..1042 CDD:214485 119/216 (55%)
Guanylate_cyc 864..1063 CDD:278633 115/201 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.