DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and acy-4

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans

Alignment Length:998 Identity:380/999 (38%)
Similarity:556/999 (56%) Gaps:163/999 (16%)


  Fly   525 LVFLIVMLICGIVYAF------LLCILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQPSKSF 583
            |:..|:.|:..|:..|      |:||.|          ::|.||:....::..:|:|        
 Worm   122 LILCILTLVISILSFFHAKRTELVCIAS----------IISCVIISACTSMRTSVTY-------- 168

  Fly   584 NGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCTLVAL 648
                   :||:.||::||:.....:.....|:.:..:    :..:.|..|   .::.:|..::.:
 Worm   169 -------LLIFSTYSLLPMSFMLMIFSTFALTFLVAF----IGVLMDYNV---GFDIILTRVMMV 219

  Fly   649 LLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQ 713
            :|.|:.|...::|.|..|||.|.|||:|:::|:...:|..:||::||:|||:::|.|:|.|:...
 Worm   220 ILVNVVGSLVYYPTEFVQRKTFHETRKCVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKDMQET 284

  Fly   714 PRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLL 778
            ..:..||||||:::|::|||||||||||:|:.:...::||.:|||||||||::|:.|.|:|||:|
 Worm   285 HEERMFHKIYIRKYEDISILFADICGFTNLASEYNPKDLVLMLNELFARFDKVASIHQCMRIKIL 349

  Fly   779 GDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQ 843
            |||||||.|:||.:.:||...||||.|||:||.||||:..||||||||||||:.|||||||.|||
 Worm   350 GDCYYCVCGVPEYQKNHAINTVEMGRDMIEAIRLVREMTLVNVNMRVGIHTGKAHCGVLGLKKWQ 414

  Fly   844 FDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGD 908
            ||||||||||||.|||||:.||||||..|...|.|.|.:|.|.|..|:.:|:..:|:|:|:|...
 Worm   415 FDVWSNDVTLANQMESGGLAGRVHITDATRSYLKGAYILEEGNGGSRSKFLEKEKIKTWLVVDRS 479

  Fly   909 --------------IYRPHKKSRNRLQVNGNISKELRMMGHGTAQKHTSKFGFGDSSESAKDPE- 958
                          :..|.|.:|       .|||:.|:.|..|..:       |.|:.:....| 
 Worm   480 PDYDNICQEATNHPVMVPWKSTR-------GISKQERLTGMSTRTR-------GASTRNGLSEEE 530

  Fly   959 ---DEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLER-----KYASEPDRM--------LC 1007
               :.|:.:|.:.|.|...::.:..||::..|.:|...:|.     ||...|.::        :|
 Worm   531 VLVENVDSHLRQGIQAIHQENWKTMHCKNWSLKYKQVRVENKFVRLKYKDIPFQVTLYVAIVAIC 595

  Fly  1008 VYFYCSLLVLLGTS-IMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIKRFSLR 1071
            :.....|:.|:..| :.::.:..:|::...| |.||:....||.||                   
 Worm   596 IGIKFGLMNLVSFSFVPQMFIVLTSVMIFIL-TRALIKHARLVSLV------------------- 640

  Fly  1072 IHSNRRISQLFAFASVALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSISLNDTELNTKMYDA 1136
                  |..||...|:.:::   |:.|::.           :|..||......|.|         
 Worm   641 ------IGVLFILLSIQIVI---LMGMYES-----------KFTCDVEKCFKNNYT--------- 676

  Fly  1137 EEPDCDFYLAYNTFLLLTLLSMMSCATYQVLRI--LLKLLLLLLASGSYMACSSNLYSRSREMSQ 1199
                 ||   :..|.:.||      ||..:|.:  :.|||:.::...|:....:....|..:.  
 Worm   677 -----DF---FEIFEICTL------ATCVILSVDFMTKLLMSMIYFSSFTVLITAKLIRINQY-- 725

  Fly  1200 ELANEEALL-RYIIDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLL 1263
                 |||| .|....:.....:|.::|.:.::|...|.||||||||.:|:..|:.....||.:|
 Worm   726 -----EALLSTYANFCVLSCLTLLLVVFSTRRSELISRYDFIWKLQALDEQLQMKRKHEQNRSVL 785

  Fly  1264 ENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIA 1328
            |||||.|||:||:.....:..||||..|:.||:||::..|.:||:|.:||||||||||||||||:
 Worm   786 ENILPSHVAKHFVEDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIIS 850

  Fly  1329 DFDELLSE----ERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVN 1389
            |||::|.:    |.|:.|||||:...|||.||||....|.  :.|||.|:|.:|.:|..|:|..|
 Worm   851 DFDQILDQILDREEFKKIEKIKTISTTYMVASGLAGRECG--DNSHVEAIALFARELLVKLESTN 913

  Fly  1390 MHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGR 1454
            :||||||.:|||||:|||||||||:.||.||||||:|||||||||.|:...||||:|::.|||..
 Worm   914 IHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRMDSGGVAGRIQVTEEVKSILEPL 978

  Fly  1455 GFELTCRGSVDVKGKGSMITYFL 1477
            |:...|||.::|||||.|.|:||
 Worm   979 GYNFECRGQINVKGKGMMETFFL 1001

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 51/201 (25%)
CYCc 686..881 CDD:214485 123/195 (63%)
Guanylate_cyc 722..895 CDD:278633 113/173 (65%)
DUF1053 <949..1005 CDD:283888 14/65 (22%)
CYCc 1259..1455 CDD:214485 117/200 (59%)
Guanylate_cyc 1285..1479 CDD:278633 117/198 (59%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831 51/201 (25%)
CYCc 260..451 CDD:214485 121/191 (63%)
Guanylate_cyc 293..448 CDD:278633 106/155 (68%)
CYCc 778..984 CDD:214485 118/208 (57%)
Guanylate_cyc 807..1003 CDD:278633 117/198 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 1 1.000
Homologene 1 1.000 H11213
Inparanoid 1 1.050 605 1.000 Inparanoid score I499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 1 1.000 T474131
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45627
Phylome 1 0.910 0.944 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4931
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.