DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and adcy6

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_002935166.2 Gene:adcy6 XenbaseID:XB-GENE-1011902 Length:1239 Species:Xenopus tropicalis

Alignment Length:1547 Identity:551/1548 (36%)
Similarity:785/1548 (51%) Gaps:397/1548 (26%)


  Fly    10 GGAVAGGVGGGATHIFRS---------------LSSESQKREWSKRLSLRGMRHGGAAGGPGGSG 59
            |.||....||....|:|.               :|||:..   ...||.|..:...:...||.||
 Frog     4 GQAVRECAGGKRLDIYRCPIEISPNLPPNAIELVSSEAAA---LPHLSTRRNKCRVSPTQPGASG 65

  Fly    60 TSSLASSKEESKHRKFFSRSASLRQAGSGGGGVGVGGVVGGSGSHQASMELHVPGQEGRGTSSGA 124
              .|.:..:||| ..:||                  |::......:.:......|::|:..::..
 Frog    66 --KLPTPSQESK-MSWFS------------------GILVPKVDERKTAWGERNGKKGKRKNTSL 109

  Fly   125 GSPQTQTQPSTPK-----------KSNWEVIEHFNTSAKGGKAVVSSSLIAAGITRCNIDESMDS 178
            ..|:..:....|:           :..|:. :|:.....||...:.|  :|.|..    |..:..
 Frog   110 CGPRYMSCLQDPEMDRNNRNNFGLRCTWQE-DHYGKKGAGGDLGLKS--VALGFE----DGEVKG 167

  Fly   179 TNSSSTCHSPMIYQRDETQLLQPGDASNLEANNPMSSGGGGGTANGPVSPSISFWFRLNRIILRL 243
            :...||   .::...|..|.|.||:.                            |.|    .|::
 Frog   168 SKMGST---EVVGTEDGEQNLTPGEC----------------------------WVR----FLQV 197

  Fly   244 CSTHQFKNLQVEMLYQRYFLRMNQSNTTHILALLLALILALSCTLLVFTTLQLRRSTSLLLEISE 308
            ..:.:|::.::|.||||||.:||||:.|.::..|:.:.|    .:|:|                 
 Frog   198 FQSKKFQSAKLERLYQRYFFQMNQSSLTMLMGALVLVCL----VMLIF----------------- 241

  Fly   309 IGLDANATVGNLTTATMKPPTLASSDQMTRGSSIPLLALASNGSWAGNGAVGGELKSAHNHNIAD 373
                                                                             
 Frog   242 ----------------------------------------------------------------- 241

  Fly   374 FEADHNGQLVWRRQKRKHYRRLHKHRYKHKSHQQHRTRYRMREKRSLQDAGLVKGGGIQTQLIVD 438
                                                                             
 Frog   242 ----------------------------------------------------------------- 241

  Fly   439 TATDDDADVYTVASDDDDDVDGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNS 503
                                         |.|:                                
 Frog   242 -----------------------------HCTH-------------------------------- 245

  Fly   504 DPPLGYGQLIPLILMQVDESVLVFLIVMLICGIVYAFLLCILSKPAMNEIFLVLVSYVILGTFLA 568
                |..|::.:.::.|  ::.:||.:|::|           ::...::.::.:|||:::....|
 Frog   246 ----GEPQVVYVSVLAV--AMALFLSLMVVC-----------NRNGFHQDYMWIVSYLVIAVLFA 293

  Fly   569 IEVAVSYAMQPSKSFNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAV 633
            ::|.....:.|..:..|....:..||:.||:||:|:|.|::.|::||.:||....|||     ..
 Frog   294 VQVLGVLMVTPRSASEGIWWSVFFIYIIYTLLPVRMRAAVLSGLILSSLHLIISWRLN-----LT 353

  Fly   634 EMIHWEELLCTLVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVL 698
            ::..|::|...::..|..|:.|:.||:|.|.:||:||.|||..|:|||..|||||||||||||||
 Frog   354 DIFLWKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVL 418

  Fly   699 PRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARF 763
            |||||||||:||..:..|..|||||||:|:|||||||||.|||||:.||||:|||..||||||||
 Frog   419 PRHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARF 483

  Fly   764 DRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIH 828
            |:||||:||||||:|||||||||||||.|.|||||.||||:|||:||:|||||..||||||||||
 Frog   484 DKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIH 548

  Fly   829 TGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSY 893
            :||||||||||.||||||||||||||||||:||..||:|||..|||.|:||||||.|.|.|||:|
 Frog   549 SGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITSATLKYLNGDYEVEPGNGGERNAY 613

  Fly   894 LKDHQIETYLIVPGDIYRPHKKSR----NRLQVNGNI-----------------SKELRMMGHGT 937
            ||:|.|:|:|:......|..:|:.    .|.:.|.|.                 ||..|.||...
 Frog   614 LKEHDIKTFLVTGCSQKRKEEKAMMARLQRARANSNEGLTRVWVPERSFPRNKGSKAFRQMGIDE 678

  Fly   938 AQKHTSKFGFGDSSESAKDPEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASEP 1002
            :.|...      :::.|.:|||||:|:|.|||||||||.||.:|.:..||.|:...||:||:.:.
 Frog   679 SSKDNR------NTQEALNPEDEVDEFLARAIDARSIDQLRKDHVKKFLLTFQTPDLEKKYSKKV 737

  Fly  1003 DRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIKR 1067
            |.....|..|:|||......:::|:|..|.|.|.:.|...::|..::|:.|.:......|:.::.
 Frog   738 DDRFGGYVTCTLLVFCFICFIQIVIFPHSFLMLGVYTSVFIILASILFVCAIYSCIKLFPAALQG 802

  Fly  1068 FSLRIHSNRRISQLFAFASVALIVLTTLLAMFQESGRQM------ELLQRRRFWLDV------NG 1120
            .|.:|..:|..|.|....::.|:..:..:.||..:.|.:      ||....:| ::|      |.
 Frog   803 VSRKIVQSRTNSTLIGILTILLVFTSAFVNMFACNHRSLTDCAGQELNISYKF-VNVCHLRMLNY 866

  Fly  1121 SISLNDTELNTKMYDAEEPDCDF--YLAYNTFLLLTLLSMMSCATY-QV-------LRILLKLLL 1175
            |:|::....     |:::|.|:|  |..|:     .|||:::|:.: |:       |.:.:::|.
 Frog   867 SLSMDSPPC-----DSDKPLCNFPEYFNYS-----ILLSLLACSVFLQISSIGKLALMLFIQILY 921

  Fly  1176 LLLASGSYMACSSNL----------YSRSREMSQELANEEALLRYIIDSIFLFAFMLALIFHSHQ 1230
            :::..|..:....|.          .:.:.::.:.|.:.:..|:: :..:.|..|:|||..|:.|
 Frog   922 IVIVEGPEVVLFDNYDLLVTVNALPINGTGDIEECLPSSKIALKF-VTPVILTVFVLALYLHAQQ 985

  Fly  1231 TEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCI 1295
            .|:|.||||:||||||.|||:||.||||||:||.||||..||.|||:||...|:||::.|:.|.:
 Frog   986 VESTARLDFLWKLQATGEKEEMEQLQAYNRRLLHNILPKDVAAHFLAREHRNDELYYQSCECVAV 1050

  Fly  1296 LFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTA 1360
            :||||.||||||||||.||||||||||||||||||||::|||:|:.:||||:.|:||||||||..
 Frog  1051 MFASICNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKFKQLEKIKTIGSTYMAASGLND 1115

  Fly  1361 NTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNA 1425
            .|.|:...:|:||:||||::|.::::.:|.||||||:|:||:||||||||||||.|||||||||.
 Frog  1116 TTYDKEGKTHITALADYAMKLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNT 1180

  Fly  1426 VNVASRMDSTGLVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFL 1477
            ||||||||||||.|.||||.::.|:|..:|:::.|||.:.|||||.|.||||
 Frog  1181 VNVASRMDSTGLPDCIQVTTDLYQVLAAKGYQMECRGVIKVKGKGEMTTYFL 1232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 76/197 (39%)
CYCc 686..881 CDD:214485 158/195 (81%)
Guanylate_cyc 722..895 CDD:278633 140/173 (81%)
DUF1053 <949..1005 CDD:283888 28/56 (50%)
CYCc 1259..1455 CDD:214485 131/196 (67%)
Guanylate_cyc 1285..1479 CDD:278633 129/194 (66%)
adcy6XP_002935166.2 AC_N 89..440 CDD:292831 120/627 (19%)
CYCc 406..601 CDD:214485 158/195 (81%)
Guanylate_cyc 442..615 CDD:278633 140/173 (81%)
DUF1053 656..740 CDD:283888 34/90 (38%)
PotE <741..925 CDD:223605 44/195 (23%)
CYCc 1007..1215 CDD:214485 138/208 (66%)
Guanylate_cyc 1040..1233 CDD:278633 129/194 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001970
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.