DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43373 and adcy1

Sequence 1:NP_001097622.2 Gene:CG43373 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_002933461.1 Gene:adcy1 XenbaseID:XB-GENE-950909 Length:1122 Species:Xenopus tropicalis

Alignment Length:1143 Identity:440/1144 (38%)
Similarity:628/1144 (55%) Gaps:203/1144 (18%)


  Fly   517 LMQVDESVLVFLIVMLICGIVYAFLLCILSKPAMNEIFLVLVSYVILGTFLAIEVAVSYAMQPSK 581
            |.|:.:..|:|       |..::||.|..|                ||         :|.::|..
 Frog   115 LQQIVKLTLLF-------GFTFSFLCCPFS----------------LG---------AYGLEPPV 147

  Fly   582 SFNGSACCIVLI-YMTYTMLPLRLREALIGGILLSVVH-LYTCLRLNAMQDEAVEMIHWEELLCT 644
            |.......::|: ::.|.:||:|...|::.|.::||.| :.|...::..:...     |..|:..
 Frog   148 SSEQGLWQLMLVTFVAYALLPVRTLLAIVFGFMVSVSHIIVTATSISPKKKRL-----WRTLVVN 207

  Fly   645 LVALLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDD 709
            .:..:..||:||:.....|:||||||::.|.|||.|||.:.||::|||||:|:|||:||||||:|
 Frog   208 AILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKED 272

  Fly   710 IAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLR 774
            .. :|.:..|||||||||:|||||||||.|||||:.||||:|||:||||||.:||.||.|:||.|
 Frog   273 FL-KPPERIFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRR 336

  Fly   775 IKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGL 839
            ||:|||||||||||.:|:.|||||.|||||||||.|..|.|...|::|||||:|||||.||||||
 Frog   337 IKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGL 401

  Fly   840 VKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLI 904
            .|||:|||||||||||.||:||:||:|||||.||:||:||||||.|.|:||||:||.|.|||:.|
 Frog   402 RKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPGYGHERNSFLKKHNIETFFI 466

  Fly   905 VP------------GDIYRPHKKSRNR---------LQVNGNISKELRMMGHGTAQKHTSKFGFG 948
            ||            .|| :|.|:.:.:         :........|:......|.:....:....
 Frog   467 VPSHRRKIFPGLILSDI-KPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR 530

  Fly   949 DSSESAKD------------PEDEVNEYLMRAIDARSIDHLRAEHCQSLLLCFKDNVLERKYASE 1001
            .:||..::            |...||.|:.|.|:||..|...:: ...:.|.:|....|:||...
 Frog   531 TASEKLRNRSSFSTNVIHNTPGTRVNRYIGRLIEARQTDSEMSD-LNFITLKYKHIEREQKYHQL 594

  Fly  1002 PDRMLCVYFYCSLLVLLGTSIMRLVVFQSSLLTLALSTGALLLLGFLVFLVACHKINFQLPSDIK 1066
            .|.........||::.....::.|::|..|.:.|      :||:..|.|||||            
 Frog   595 HDEYFTSAVVLSLILAALFGLVYLLIFPQSTIVL------ILLVFCLCFLVAC------------ 641

  Fly  1067 RFSLRIHSNRRISQLFAFASVALIVLTTLLAMF-------QESGRQMELLQRRRFWLDVNGSISL 1124
              .:.:|    ::::..|.....|.:.|:|.:|       ...|..:..:.  ..|...|.|..:
 Frog   642 --IMYLH----VTRVQCFPGCLTIQIRTILCIFIVILIYSVAQGCVVGCMP--WIWRSNNSSSIV 698

  Fly  1125 NDTELNTKMYDAEEPDCDFYLAYNTFLLLTLLSMMSCATYQVLRILLKLLLLLLASGSYMACSSN 1189
            ..|.........|.| ||  .|:.|| |..::..:|.|.:..:....|::|||..        :.
 Frog   699 IITPKGENKTMNERP-CD--TAHYTF-LSCVVGTLSLAIFLRISSFPKMVLLLFV--------TI 751

  Fly  1190 LYSRSREMS---QELANEEALLRYI--IDSIFLFAFMLALIFHSHQTEATYRLDFIWKLQATEEK 1249
            ||....|:|   :.|..:.:.:|..  |.:|.||:..|||  ||.|.:...|||::|.:||.||:
 Frog   752 LYIVILEISGYRKTLGGDTSYMRGYEPILAILLFSCSLAL--HSRQVDLKLRLDYLWAVQAEEER 814

  Fly  1250 EDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNN 1314
            :|||.::..|:::|.|:||.|||:|||.......|||::....|.::|||||||::||:||:|||
 Frog   815 DDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNN 879

  Fly  1315 EGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVN---FSHVTAMAD 1376
            .||||||||||||||||||:.:|.::.|||||:.|:|||.|.||...|..:..   :||::.:||
 Frog   880 MGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLAD 944

  Fly  1377 YALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHI 1441
            :::::||.::|:|..|:|.|.:|:|||:||||||||||.:||||||||.|||||||||||:...|
 Frog   945 FSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKI 1009

  Fly  1442 QVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFLKGRRPIDAKELELAKTEVEPPKTLTLAKE 1506
            |||:::.:||:...:|..|||.|.|||||.|:||||:|                           
 Frog  1010 QVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTYFLEG--------------------------- 1047

  Fly  1507 PEKLDSGTATEKQREQVKEQGSTEQEDDLLPSPDIDMNSNMQNLTAQRRKSLCRQHNISSSFGTT 1571
              |:| ||                             ||..::|..:|:.....:.||.:..||:
 Frog  1048 --KID-GT-----------------------------NSQTRSLNLERKMYPYGRTNIQTKLGTS 1080

  Fly  1572 VSSSTGIT------------PSISNSSSVVTIGALPAI 1597
            ..:.:.|:            |:.|:::.  |:..||::
 Frog  1081 CPAVSSISNFPVKAGQGALQPTTSHANQ--TLHYLPSV 1116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 63/199 (32%)
CYCc 686..881 CDD:214485 143/195 (73%)
Guanylate_cyc 722..895 CDD:278633 131/173 (76%)
DUF1053 <949..1005 CDD:283888 17/68 (25%)
CYCc 1259..1455 CDD:214485 111/199 (56%)
Guanylate_cyc 1285..1479 CDD:278633 114/197 (58%)
adcy1XP_002933461.1 AC_N <37..282 CDD:292831 65/205 (32%)
CYCc 248..443 CDD:214485 143/196 (73%)
Guanylate_cyc 284..466 CDD:278633 136/182 (75%)
CYCc 817..1028 CDD:214485 114/211 (54%)
Guanylate_cyc 850..1047 CDD:278633 114/197 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D46761at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.