DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Agpat3 and LPAT3

Sequence 1:NP_001246793.1 Gene:Agpat3 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_175537.1 Gene:LPAT3 AraportID:AT1G51260 Length:376 Species:Arabidopsis thaliana

Alignment Length:375 Identity:120/376 (32%)
Similarity:203/376 (54%) Gaps:15/376 (4%)


  Fly    23 LIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTV 87
            |:.:.:.:.|..|||.:|.|||:..:.::|..:.|:|::.......|:.|||::.||:|..|:.:
plant     7 LVFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACIKINL 71

  Fly    88 YMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLA 152
            |:|.|..|. .||||.|::.||:.:||||.||::.:::|.||:..|..||..:|:|||||..|.:
plant    72 YVDAETLEL-IGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKKEAKYLPIIGWSMWFS 135

  Fly   153 EFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHL 217
            :::||.|::.:|:..:....|.:..:|...||.|..||||||..|.||:.::|..|.:...::.|
plant   136 DYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASIRSLPSPRNVL 200

  Fly   218 IPRTKGFTASLAPIRGLCPVIYDINLAYRPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVPEDE 282
            |||||||.::::.||...|.|||..|.......|| |:|.:..|:|.|.:|.|||..:.::||.:
plant   201 IPRTKGFVSAVSEIRSFVPAIYDCTLTVHNNQPTP-TLLRMFSGQSSEINLQMRRHKMSELPETD 264

  Fly   283 KEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYY 347
            ...|.|.|:||:.||..::.:. |...|....:.::     .|.:..|:..:.|       :.:.
plant   265 DGIAQWCQDLFITKDAQLEKYF-TKDVFSDLEVHQI-----NRPIKPLIVVIIW-------LGFL 316

  Fly   348 VITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYGSSKSVAK 397
            |........|.:.:.:..::.||.:.:..|....||...|:.....:.||
plant   317 VFGGFKLLQWLSIVASWKIILLFVFFLVIATITMQILIQSSESQRSTPAK 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 117/364 (32%)
LPLAT_LCLAT1-like 75..271 CDD:153252 78/196 (40%)
Acyltransf_C 258..336 CDD:292694 20/78 (26%)
LPAT3NP_175537.1 PLN02380 1..376 CDD:178006 120/376 (32%)
LPLAT_LCLAT1-like 59..250 CDD:153252 76/193 (39%)
Acyltransf_C 240..312 CDD:292694 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10591
Inparanoid 1 1.050 223 1.000 Inparanoid score I1149
OMA 1 1.010
OrthoDB 1 1.010 D959325at2759
OrthoInspector 1 1.000 T32290
orthoMCL 1 0.900 OOG5_130707
Panther 1 1.100 O PTHR10983
Phylome 1 0.910 0.734 Consistency score
98.980

Return to query results.
Submit another query.