DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat5

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_081068.1 Gene:Agpat5 / 52123 MGIID:1196345 Length:365 Species:Mus musculus


Alignment Length:266 Identity:67/266 - (25%)
Similarity:130/266 - (48%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IDKRLFRKLMYYACYSLYSQLI-FVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWL 116
            :|.||         |.:|..:: |..:.|.|.::.:|   .|..|:  ||:|:.:.||:..:||:
Mouse    50 VDDRL---------YCVYQNMVLFFFENYTGVQILLY---GDLPKN--KENVIYLANHQSTVDWI 100

  Fly   117 NGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF--VFLNRNFDQDKTIITEQLKVVFSYP 179
            ...|:..:...||:.:...|..::::|:  :|::.|:.  :::.|:...:...:..:|:...:..
Mouse   101 VADMLAARQDALGHVRYVLKDKLKWLPL--YGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG 163

  Fly   180 DPTWLLLNAEGTRFTPAKHE---ASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDI 241
            .|.:|::..||||:.....:   ||..||.:||:.||||.|.||.|....:...::.....|||:
Mouse   164 TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDV 228

  Fly   242 NLAYRPTDK------TPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKII 300
            .:.|...:|      .|.:|...|..:..:.|:...||...:|||:::....||...|..||:::
Mouse   229 TVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDRLL 293

  Fly   301 DSFLET 306
            ..|.::
Mouse   294 IEFYDS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 67/266 (25%)
LPLAT_LCLAT1-like 75..271 CDD:153252 51/206 (25%)
Acyltransf_C 258..336 CDD:292694 13/49 (27%)
Agpat5NP_081068.1 LPLAT_LCLAT1-like 63..264 CDD:153252 51/207 (25%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 93..98 1/4 (25%)
Acyltransf_C 260..319 CDD:292694 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51956
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.