DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Agpat3 and Agpat3

Sequence 1:NP_001246793.1 Gene:Agpat3 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_443747.2 Gene:Agpat3 MGIID:1336186 Length:376 Species:Mus musculus

Alignment Length:382 Identity:152/383 (40%)
Similarity:233/383 (61%) Gaps:11/383 (3%)


  Fly    12 MGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFV 76
            ||.|..||...::||.|...|..|||.|||.||.. :.:.||.|.|:|::.....|||:|||:.:
Mouse     1 MGLLAYLKTQFVVHLLIGFVFVVSGLIINFTQLCT-LALWPISKHLYRRINCRLAYSLWSQLVML 64

  Fly    77 SDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRY 141
            .:|::.::.|::.|:...: |.|||||::|:||.:|||:|.||.:||:.||||:.|..||:.:..
Mouse    65 LEWWSCTECTLFTDQATVD-HFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLC 128

  Fly   142 VPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQ 206
            ||:|||.|:..|.||..|.:::|:..:.|.|:.:..||:..|.||..||||||..||..|::.|.
Mouse   129 VPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLADYPEYMWFLLYCEGTRFTETKHRISMEVAA 193

  Fly   207 ERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDINLAYRPTDKTPATMLSLLHGKSVEPHLLMR 271
            .:|:..||:||:|||||||.::..:||....|||:.|.:| .:|.| ::|.:|:||..|..:.:|
Mouse   194 SKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNFR-GNKNP-SLLGILYGKKYEADMCVR 256

  Fly   272 RIPLEQVPEDEKEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCW 336
            |.|||.:|.||..||.||..|:.|||.:.:.:.:.|.|   .|.:..||    ||..:|:||:||
Mouse   257 RFPLEDIPADETSAAQWLHKLYQEKDALQEMYKQKGVF---PGEQFKPA----RRPWTLLNFLCW 314

  Fly   337 AVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYGSSK 393
            |...||.:|.:|:....:.:....:|.|..:|...:.:.:.|..|:|.|.|:||:.:
Mouse   315 ATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQE 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 144/364 (40%)
LPLAT_LCLAT1-like 75..271 CDD:153252 81/196 (41%)
Acyltransf_C 258..336 CDD:292694 31/78 (40%)
Agpat3NP_443747.2 PLN02380 12..325 CDD:178006 131/313 (42%)
LPLAT_LCLAT1-like 62..256 CDD:153252 82/194 (42%)
HXXXXD motif 96..101 2/5 (40%)
Acyltransf_C 243..314 CDD:292694 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40437251
eggNOG 1 0.900 E1_COG0204
Hieranoid 1 1.000
Homologene 1 1.000 H10591
Inparanoid 1 1.050 289 1.000 Inparanoid score I2780
Isobase 1 0.950 0 Normalized mean entropy S3038
OMA 1 1.010
OrthoDB 1 1.010 D959325at2759
OrthoFinder 1 1.000 FOG0001523
OrthoInspector 1 1.000 T130877
orthoMCL 1 0.900 OOG5_130707
Panther 1 1.100 O PTHR10983
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3473
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.