DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and CG34462

DIOPT Version :8

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster

Alignment Length:137 Identity:28/137 - (20%)
Similarity:56/137 - (40%) Gaps:43/137 - (31%)


  Fly    39 YSYGY-----RDENAA-RAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAE-------- 89
            ||:||     :.:|:. |.|....:|:.:|.|.|...||:::..:|.|....|:.|:        
  Fly    62 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGD 126

  Fly    90 -------ASNQPQAPVDKGKAPLP-----------------VTD--TEEVQQAR---LNHLNALR 125
                   .:.:|...|::.|:..|                 |.|  .::::|..   |||::..:
  Fly   127 EKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTK 191

  Fly   126 EAREKAL 132
            :..:.|:
  Fly   192 DVLKPAV 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/48 (31%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.