DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr92F

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster

Alignment Length:150 Identity:53/150 (35%)
Similarity:64/150 (43%) Gaps:26/150 (17%)


  Fly     8 ILGGLLALTSAAGLPQRPSSGYQEQDTARAFYSYGYRDENAARAEYSSRDGTSRGFYSYVDADGK 72
            |...||..|.:|......|:.||..|.....|||||.|.|:.:.|..|.|||:.|.|||||..|.
  Fly     6 IAAALLISTVSASWHGAVSTQYQHLDPHSHTYSYGYADPNSQKHETRSHDGTTHGSYSYVDGHGH 70

  Fly    73 LQTVRYEANGVQGFKAEASNQPQ-------------------APVDKGKAPLPV-------TDTE 111
            :|:|.|.|:...||.|..:|.||                   ||...|...:||       .||.
  Fly    71 VQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTP 135

  Fly   112 EVQQARLNHLNALREAREKA 131
            |||.|:..|..|...|...|
  Fly   136 EVQHAKAAHAAAHAAAAHNA 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 23/43 (53%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49298
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.