DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Ccp84Ad

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster

Alignment Length:136 Identity:39/137 (28%)
Similarity:58/137 (42%) Gaps:32/137 (23%)


  Fly     4 FTWTILGGLLALTSAAGLP---------------QRP----------SSGYQEQDTARAF-YSYG 42
            |.:..|..|:|..||..||               |.|          :...:|.|....: |:|.
  Fly     3 FKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYD 67

  Fly    43 YRD--ENAARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPVDKGKAP 104
            .:|  ...::::...||| ..||.||.:||||..:||:|.|:.:.||.|..:.:   |:.|..|.
  Fly    68 VQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE---PLVKAVAV 129

  Fly   105 LPVTDT 110
            .||..|
  Fly   130 APVVKT 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/46 (39%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49404
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.