DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Ccp84Af

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:138 Identity:37/138 - (26%)
Similarity:56/138 - (40%) Gaps:42/138 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLALTSAAG---LP---------------QRP----------SSGYQEQDTARAF-YSYGYRD-- 45
            :|||.|||.   ||               |.|          :...:|.|....: ::|..:|  
  Fly     8 VLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSL 72

  Fly    46 ENAARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQP----------QAPVD 99
            ...::::...||| ...|.||.:|:||..:.|:|.::.|.||.|..:..|          .|||.
  Fly    73 SGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVA 137

  Fly   100 KGKAPLPV 107
            ...||:||
  Fly   138 VAAAPIPV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 13/45 (29%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.