DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Edg84A

DIOPT Version :8

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster

Alignment Length:119 Identity:38/119 - (31%)
Similarity:55/119 - (46%) Gaps:6/119 - (5%)


  Fly    12 LLALTSAAGLPQRPSSGYQEQDTARAFYSYGY----RDENAARAEYSSRDG-TSRGFYSYVDADG 71
            |:.|..|..||.: |||.::...:...||:.|    .:....:::..|||| ...|.||..||||
  Fly    11 LIGLAQAGPLPAK-SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADG 74

  Fly    72 KLQTVRYEANGVQGFKAEASNQPQAPVDKGKAPLPVTDTEEVQQARLNHLNALR 125
            ..:||.|.|:.|:||.|....:|.:.......|.......:||...|..|.||:
  Fly    75 YRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALK 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/47 (38%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49395
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.