powered by:
Protein Alignment Cpr72Ec and Edg84A
DIOPT Version :9
| Sequence 1: | NP_648884.1 |
Gene: | Cpr72Ec / 39816 |
FlyBaseID: | FBgn0036619 |
Length: | 429 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_524247.1 |
Gene: | Edg84A / 40818 |
FlyBaseID: | FBgn0000552 |
Length: | 188 |
Species: | Drosophila melanogaster |
| Alignment Length: | 119 |
Identity: | 38/119 - (31%) |
| Similarity: | 55/119 - (46%) |
Gaps: | 6/119 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 LLALTSAAGLPQRPSSGYQEQDTARAFYSYGY----RDENAARAEYSSRDG-TSRGFYSYVDADG 71
|:.|..|..||.: |||.::...:...||:.| .:....:::..|||| ...|.||..||||
Fly 11 LIGLAQAGPLPAK-SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADG 74
Fly 72 KLQTVRYEANGVQGFKAEASNQPQAPVDKGKAPLPVTDTEEVQQARLNHLNALR 125
..:||.|.|:.|:||.|....:|.:.......|.......:||...|..|.||:
Fly 75 YRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALK 128
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45453175 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.