DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr76Bd

DIOPT Version :8

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster

Alignment Length:92 Identity:29/92 - (31%)
Similarity:42/92 - (45%) Gaps:8/92 - (8%)


  Fly    15 LTSAAGLPQRPSSGYQEQDT-ARAFYSYGYRDENAA--RAEYSSRDG-TSRGFYSYVDADGKLQT 75
            :|..|.|...|....:..|. .|..:.|...|.:..  :.:...||| ..:|.||.|:.||.::|
  Fly  1133 VTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRT 1197

  Fly    76 VRYEANGVQGFKAEASNQPQAPVDKGK 102
            |:|.|:...||.||..|..    |:||
  Fly  1198 VKYYADWETGFHAEVINSR----DQGK 1220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/45 (33%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49269
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.