DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr72Ea

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster

Alignment Length:60 Identity:29/61 (48%)
Similarity:41/61 (67%) Gaps:1/61 (2%)


  Fly    39 YSYGYRDENAARAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPV 98
            |||||.:..:::.|..:.||.::|:|||.||.||||||.|.|:. :||...|:|.|:|.|
  Fly    49 YSYGYSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKV 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 22/43 (51%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134581443
eggNOG 1 0.900 E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.