DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr66D

DIOPT Version :8

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster

Alignment Length:142 Identity:42/142 - (29%)
Similarity:66/142 - (46%) Gaps:18/142 - (12%)


  Fly    16 TSAAGLPQRPSSGYQ-----EQDTARAFYSYGYRDENAARAEYSS----RDGT-SRGFYSYVDAD 70
            ||..|..|...|..|     |.|...:.|.:|:..::.....|.:    |||: .:|.||.||:|
  Fly   130 TSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSD 194

  Fly    71 GKLQTVRYEANGVQGFKAEASNQPQAPVDKGKAPLPVTDTEEVQQARLNHLNALREAREKALATS 135
            |.::||:|.|:..:|||||...:|...|.|...|.|.|        :|......:..:|.:...|
  Fly   195 GFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPT--------QLLRAGGHKAQQEYSSGPS 251

  Fly   136 LREEADRRQQEQ 147
            .::...::||:|
  Fly   252 KQQYQHQQQQQQ 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 17/47 (36%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.