DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr64Ab

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster

Alignment Length:76 Identity:28/77 (36%)
Similarity:41/77 (53%) Gaps:10/77 (13%)


  Fly    39 YSYGYRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPV 98
            |::.|..::|    ::::...||| ..:|.||.|||||.|:||.|.|:.:.||.|...   :.||
  Fly    42 YAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQ---RGPV 103

  Fly    99 DKGKAPL--PV 107
            .....||  ||
  Fly   104 PVAARPLVAPV 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 19/48 (40%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.