DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Crys

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster

Alignment Length:410 Identity:113/411 (27%)
Similarity:174/411 (42%) Gaps:93/411 (23%)


  Fly    25 PSSGYQEQDTARAFYSYGY--RDENAA--RAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQ 84
            |:|. ::.|| |..||:.|  ||....  :.:...||| ..:|.||.::.||..:.|.|.|:.|.
  Fly    65 PNSN-EDYDT-RPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVS 127

  Fly    85 GFKAEASNQPQAPVDKGKAPLPVTDTEEVQQARL-----NHLNALREAREKALATSLREE---AD 141
            ||.|..|.|               ..:|.||.||     :..|:|.|.:.:..|.::.|.   .:
  Fly   128 GFNAIVSKQ---------------RLDEQQQQRLSASTSSRFNSLEELQTRLTAQAIAEAQSLVE 177

  Fly   142 RRQQEQIRNNNEDQQSGEQSLTDEDAAILERVRAELSAMLADRQRELNLPRNRDDREQREKQEIR 206
            .:|..|::...::::..|....::...::|:.:.::                    :|:|:|.::
  Fly   178 AQQASQLQLEAQNRRESENQARNQAQQLMEQFQQQV--------------------QQQEQQRLQ 222

  Fly   207 QDQRKELRQDLRQEQRQDQREDRRQDQREDRRQNQREDRRQDQRE---------ERREDQREERG 262
            |:|  :|| ||::.|.|..||:|.::||| |.|.:||.|.:.|||         ||....||.|.
  Fly   223 QEQ--QLR-DLQRLQEQRDREERDREQRE-REQREREQRERQQREQELRERELRERELRDRELRD 283

  Fly   263 EDQREERREDRREDRREDRRQDLRIDQESRQDLLQDLRQDLRQD---------------LRQELR 312
            .:.|:..:.||.:..||||||.....|...|.||......|.|.               |...|.
  Fly   284 RELRDREQRDREQRDREDRRQQAERRQSQNQRLLDQQTLLLAQSLPSIQATVVSHPPTLLATRLP 348

  Fly   313 QDLRQDQSRNQESL---RDSSQIRE--NARQISSDRDGDDLRL-----RTVYSLADLSSSSYLKL 367
            .......||....|   ||....|:  ||| |:.||....|.|     .||.:.. :||...|:.
  Fly   349 VSTTTSSSRTTTLLTRERDLEAWRQLPNAR-ITIDRSSQPLILSQPSSATVQAQL-ISSPLLLES 411

  Fly   368 GDLASAEKLLEDRLDNSDLR 387
            |:|   ..|:..||:.:..|
  Fly   412 GNL---NGLITTRLNGNAAR 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 16/48 (33%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49273
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.