DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr30B

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:53 Identity:18/54 (33%)
Similarity:27/54 (50%) Gaps:4/54 (7%)


  Fly    54 SSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPVDKGKAPLP 106
            |.:|....|.|..:|:||..:.|:|:|:...||:|....:|    ...|.|||
  Fly    53 SRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREP----TDIKIPLP 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 10/28 (36%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49481
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.