DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr30F

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:85 Identity:30/85 - (35%)
Similarity:42/85 - (49%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ARAFYSYGY--RDENAA--RAEYSSRDGTS-RGFYSYVDADGKLQTVRYEANGVQGFKAEASNQP 94
            |.|.|.:.|  .||:..  :::..||.|.. :|.|:.|||||.|:||.|.::...||.|.....|
  Fly    41 APAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDP 105

  Fly    95 -------QAPVDKGKAPLPV 107
                   .||:.|..||.|:
  Fly   106 LGQKVIKAAPIAKLLAPAPL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/47 (38%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.