DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr30F

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster

Alignment Length:85 Identity:30/86 (35%)
Similarity:42/86 (49%) Gaps:12/86 (14%)


  Fly    35 ARAFYSYGY--RDENAA--RAEYSSRDGTS-RGFYSYVDADGKLQTVRYEANGVQGFKAEASNQP 94
            |.|.|.:.|  .||:..  :::..||.|.. :|.|:.|||||.|:||.|.::...||.|.....|
  Fly    41 APAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDP 105

  Fly    95 -------QAPVDKGKAPLPV 107
                   .||:.|..||.|:
  Fly   106 LGQKVIKAAPIAKLLAPAPL 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/48 (38%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:278791 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49502
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.