DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ec and Cpr5C

Sequence 1:NP_648884.1 Gene:Cpr72Ec FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster

Alignment Length:137 Identity:40/138 (29%)
Similarity:58/138 (42%) Gaps:33/138 (24%)


  Fly     4 FTWTILGGLLALTSAAGLP------QRPSSGY--------------------QEQDTARAFYSYG 42
            |.:..|..|:|..||..||      ..|.:.|                    .|:......|.|.
  Fly     3 FKFVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYA 67

  Fly    43 YRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQA-PVDKG 101
            |..::|    ::::...||| ..||.||.||:||..:||:|.|:.:.||.|..:.:|.. .|.|.
  Fly    68 YDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKT 132

  Fly   102 KAPL-PV 107
            .||: ||
  Fly   133 VAPVAPV 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 19/48 (40%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49364
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.