DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Eb and Cpr30B

Sequence 1:NP_648883.1 Gene:Cpr72Eb FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:86 Identity:23/87 (26%)
Similarity:36/87 (41%) Gaps:12/87 (14%)


  Fly     2 YFLNLCLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGYMAPLYSKHETRTVDGVI 66
            |.|.|||......:.:.:.. :|||....   .|:...|.|       ...:.|:.|:|. |..:
  Fly     7 YLLCLCLASAVWAIELQAEP-DYGPVAYE---FQWSVNDPH-------TGDIKSQKESRK-DDKV 59

  Fly    67 RGTFSHIDANGETQTVDYVAD 87
            .|.:..||::|..:.|.|.||
  Fly    60 EGVYELIDSDGYRRIVQYKAD 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 12/44 (27%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49450
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.