DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr92F

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:401 Identity:110/401 - (27%)
Similarity:163/401 - (40%) Gaps:112/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLGSLSLA-HG-LALYY----PYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEPLSSKQETR 64
            ||:.::|.: || ::..|    |:::|                      |||||::|.|.|.|||
  Fly    10 LLISTVSASWHGAVSTQYQHLDPHSHT----------------------YSYGYADPNSQKHETR 52

  Fly    65 TLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFHVAATNLPKAKVPQESLEFSP-RSASH------ 121
            :.||.|.|.|||.|..|.:|:|:|.|| :.||:...||||:|  ||  :..:| .:|:|      
  Fly    53 SHDGTTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQA--PQ--VHAAPVYAAAHAHGAYA 113

  Fly   122 -----------------PVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHHTVVES--------GRS 161
                             |||.....||:.:||.......|:   ...||....|        |::
  Fly   114 PYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHN---AGGHHLYKRSIYGGGWAYGQA 175

  Fly   162 AH---PDGHHPVEHHEHRVAVAQHPVGH----------H--PVEVPHHHTVVETGRSAH------ 205
            ||   ..|..||:..:.:.|.|:|...|          |  |||.|.    |:..::||      
  Fly   176 AHVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGHVAHAHGAPVETPE----VQHAKAAHFAAHAA 236

  Fly   206 -PDGH--HPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIEHHEHPVSGSDPS 267
             ..||  .|:.|..:.|.|..:.|   ||:.|.    |:..::||.........|.....||...
  Fly   237 ARSGHAVSPINHGGYHVPVIHNGV---PVDTPE----VQHAKAAHYAALSQASAHGGASHGSWDD 294

  Fly   268 GSHGGHSQLPHPVSDTAEVAAAKSLHLQRVHDEGVRNQVLAKIPVAV--ARSHHVVVPAPVYGYT 330
            ||:.|..:..|...::   .|:...|...:|...:.|.|..: |..|  ||:.|:...|.. |:.
  Fly   295 GSYDGRWEQSHSSHNS---YASGYAHKGPIHIPVIHNGVPVE-PAEVQHARAAHLNALAAA-GHG 354

  Fly   331 IPRYYTPGFYY 341
            .|..:  |.||
  Fly   355 APASH--GSYY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 25/46 (54%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.