| Sequence 1: | NP_648882.1 | Gene: | Cpr72Ea / 39814 | FlyBaseID: | FBgn0036617 | Length: | 341 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650905.2 | Gene: | Cpr92F / 42450 | FlyBaseID: | FBgn0038819 | Length: | 381 | Species: | Drosophila melanogaster |
| Alignment Length: | 401 | Identity: | 110/401 - (27%) |
|---|---|---|---|
| Similarity: | 163/401 - (40%) | Gaps: | 112/401 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LLLGSLSLA-HG-LALYY----PYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEPLSSKQETR 64
Fly 65 TLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFHVAATNLPKAKVPQESLEFSP-RSASH------ 121
Fly 122 -----------------PVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHHTVVES--------GRS 161
Fly 162 AH---PDGHHPVEHHEHRVAVAQHPVGH----------H--PVEVPHHHTVVETGRSAH------ 205
Fly 206 -PDGH--HPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIEHHEHPVSGSDPS 267
Fly 268 GSHGGHSQLPHPVSDTAEVAAAKSLHLQRVHDEGVRNQVLAKIPVAV--ARSHHVVVPAPVYGYT 330
Fly 331 IPRYYTPGFYY 341 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpr72Ea | NP_648882.1 | Chitin_bind_4 | 49..95 | CDD:278791 | 25/46 (54%) |
| Cpr92F | NP_650905.2 | Chitin_bind_4 | 37..84 | CDD:278791 | 25/46 (54%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45453278 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12236 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||