DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr92A

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster

Alignment Length:264 Identity:72/265 (27%)
Similarity:99/265 (37%) Gaps:61/265 (23%)


  Fly     4 PLLLLGSLSLAHGLALYYPYAYTAEGSAVFTPTQRQYIAKDELGQYSY------GYSEPLSSKQE 62
            ||...|..:..||   ..|..|.|...|...|       .|...:||:      ||:..|.|:.|
  Fly    33 PLHHYGGYAPQHG---PLPGPYVAPKPAAPEP-------YDPDPKYSFGYDIQDGYTGDLKSQHE 87

  Fly    63 TRTLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFHVAATNLPKA-KVPQE-SLEFSPRSASHPVD 124
            ||..| :.:|.||..|..|..:||:|.|| :.||:......|.| |.|.. :...:|..|..|. 
  Fly    88 TRHGD-VVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAHLAPVVAPAPAPVPA- 150

  Fly   125 HHVEHHAEVSHAVVQHPVGHHPIEV-PHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHP 188
            |:....|.....|.:.|:..:|:.: |:|.     |..|...|..|          |..|.   |
  Fly   151 HYGPAPAPPLPPVPKAPLLSYPLALGPYHR-----GAPAPAPGPAP----------APAPA---P 197

  Fly   189 VEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHS 253
            |.||....|:       |..|.   |..:| |:|..|..::|.          .|.:..|..||:
  Fly   198 VSVPVATPVL-------PSAHF---HAAYP-ALAHSPYAHYPA----------PGPAPAPVEPHA 241

  Fly   254 IEHH 257
            ..||
  Fly   242 YYHH 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 21/53 (40%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 13/54 (24%)
Chitin_bind_4 68..120 CDD:278791 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.