DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Ccp84Ac

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster

Alignment Length:228 Identity:58/229 (25%)
Similarity:89/229 (39%) Gaps:63/229 (28%)


  Fly     1 MKYPLLLLGSLSLAHGLALYYPYAYTAEGSAVFTPTQRQYI----------------AKDELGQY 49
            |.:.|:.|.|..||...|...|.....:...::...|.|::                ..|...:|
  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPKY 65

  Fly    50 SYGY--SEPLS--SKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVP 108
            ::.|  .:.||  ||.:..:.|| :.||.||..||.|..:||.|.||: .||:......|.|.|.
  Fly    66 NFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVH 130

  Fly   109 QESLEFSPRSASHPVDHH---------VEHHAEVSHAVVQHPV-----------GHHPIEVP--- 150
            .:.:      |:.||.:|         ::.:|..|.|.|. |.           ..|..|.|   
  Fly   131 HKVV------AAAPVQYHHAPAAAAAVIKSYASPSQAYVA-PTYAAPAYTAPAYATHQAEQPQER 188

  Fly   151 ----HHHTVVES---GRSAHPDGHHPVEHHEHR 176
                ||:...||   .::|| :||   |::.|:
  Fly   189 EHQQHHYASYESPAHAQAAH-EGH---EYYHHQ 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 21/52 (40%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49336
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.