DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Ccp84Ad

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster

Alignment Length:204 Identity:54/205 (26%)
Similarity:78/205 (38%) Gaps:58/205 (28%)


  Fly    23 YAYTAEGSAVFTPTQRQY----------------------IAK-----DELGQYSYGY--SEPLS 58
            :|..|..||...|.|:.|                      :||     |...||.|.|  .:.||
  Fly     9 FALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLS 73

  Fly    59 --SKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSP--R 117
              ||.:....|| :.:|.||..||.|..:||.|.||. .||:......|..|    ::..:|  :
  Fly    74 GDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVK----AVAVAPVVK 134

  Fly   118 SASHPVDHH----VEHHAEVSHAVVQHPVGHH--PIEVPHHHTVVESGRSAHPDGHH--PVEHHE 174
            :.:.||.|:    |.|:|..:......||.|:  |..|          ::..|..|:  |..:..
  Fly   135 TVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVV----------KTVAPVAHYAAPATYTS 189

  Fly   175 HRV-AVAQH 182
            :.. |||.|
  Fly   190 YAAPAVAYH 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 21/52 (40%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49324
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.