DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:204 Identity:54/204 - (26%)
Similarity:78/204 - (38%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YAYTAEGSAVFTPTQRQY----------------------IAK-----DELGQYSYGY--SEPLS 58
            :|..|..||...|.|:.|                      :||     |...||.|.|  .:.||
  Fly     9 FALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLS 73

  Fly    59 --SKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSP--R 117
              ||.:....|| :.:|.||..||.|..:||.|.||. .||:......|..|    ::..:|  :
  Fly    74 GDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVK----AVAVAPVVK 134

  Fly   118 SASHPVDHH----VEHHAEVSHAVVQHPVGHH--PIEVPHHHTVVESGRSAHPDGHH--PVEHHE 174
            :.:.||.|:    |.|:|..:......||.|:  |..|          ::..|..|:  |..:..
  Fly   135 TVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVV----------KTVAPVAHYAAPATYTS 189

  Fly   175 HRV-AVAQH 182
            :.. |||.|
  Fly   190 YAAPAVAYH 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 21/52 (40%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 20/51 (39%)

Return to query results.
Submit another query.