DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Ccp84Ae

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster

Alignment Length:115 Identity:36/116 (31%)
Similarity:53/116 (46%) Gaps:17/116 (15%)


  Fly     5 LLLLGSLSLAHGLALYYPYAYTAEGSAVFT---PTQRQYIAKDELG---QYSYGY--SEPLS--S 59
            ::.|...::|||..|     .||...||.:   |...:.:..:|:.   ||:|.|  .:.||  :
  Fly     6 VIALALFAVAHGAVL-----RTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDN 65

  Fly    60 KQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKV 107
            |......|| :.:|.||..||.|..:||.|.||: .||:......|.|.|
  Fly    66 KGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAV 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 20/52 (38%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49316
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.