DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Edg84A

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster

Alignment Length:192 Identity:57/193 (30%)
Similarity:78/193 (40%) Gaps:48/193 (25%)


  Fly    16 GLALYYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYS----EPLSSKQETRTLDG-ITQGYYS 75
            |||...|....:.||      :..|   |...|||:.|.    |....|.::.:.|| :..|.||
  Fly    13 GLAQAGPLPAKSSGS------EDTY---DSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYS 68

  Fly    76 YRDAAGKLQTVNYVADN-KGFHVAATNLP------------KAKVPQESLE-------FSPRSAS 120
            ..||.|..:||:|.||: :||:......|            .|.||:..|:       ..|.|.:
  Fly    69 VNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQA 133

  Fly   121 HPVDHH----VEHHAEVSHAVVQHPVGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVA 178
            ..|.|.    |.|||.|:| ||.|....|.. |.||..|:::      ..||  .||.|.::
  Fly   134 SAVVHRSFAPVVHHAPVTH-VVHHAAPAHSF-VSHHVPVLKT------TVHH--AHHPHAIS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/52 (37%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49320
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.