DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr76Bc

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster

Alignment Length:277 Identity:59/278 (21%)
Similarity:108/278 (39%) Gaps:93/278 (33%)


  Fly    49 YSYG----YSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFH-----VAATNLP 103
            :|||    ::..:.|:.|:|..||: :|:||..:..|.::||:|.|| .|||:     |.|.:.|
  Fly    58 FSYGVKDLHTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHP 121

  Fly   104 KAKVPQESLEFSPRSASHPVDHHV--EHHAEVSHAV--VQHPV----GHHP-----IEVPHH--- 152
            ..:.|:.|.:.:..::...::|:.  :.|..:|..:  ::.|:    ..||     ||:..|   
  Fly   122 ITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARI 186

  Fly   153 -----------------------------HTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHP 188
                                         |.:.:..:...|.  :.|:..:.:..:...|..:.|
  Fly   187 KQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPT--YAVQEGDWKAVIVNEPKEYRP 249

  Fly   189 VEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHH--HTVVESGRSAHP--- 248
                 |:|   ||..||   .|..:|::             |.|:||:  |......:|.|.   
  Fly   250 -----HYT---TGSPAH---SHFYDHYK-------------PKEIPHNYIHKPSVPQQSLHTSFS 290

  Fly   249 ------EVPHSIEHHEH 259
                  .:|.||.:|.|
  Fly   291 PSKPRINIPESISNHIH 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/51 (37%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.