DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr72Eb

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster

Alignment Length:331 Identity:83/332 (25%)
Similarity:114/332 (34%) Gaps:158/332 (48%)


  Fly    26 TAEGSAVFTPTQR-----------QYIAKDELGQYSYGYSEPLSSKQETRTLDGITQGYYSYRDA 79
            |..|.||.:||..           ||..:||.|||:|||..||.||.||||:||:.:|.:|:.||
  Fly    11 TTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGYMAPLYSKHETRTVDGVIRGTFSHIDA 75

  Fly    80 AGKLQTVNYVADNKGFHVAATNLPKAKVPQESLEFSPRSASHPVDHHVEHHAEVSHAVVQHPVGH 144
            .|:.|||:||||.:|||| .:|||..:..||:.|                               
  Fly    76 NGETQTVDYVADAEGFHV-TSNLPNQQANQETPE------------------------------- 108

  Fly   145 HPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVEVPHHHTVVETGRSAHPDGH 209
                       |.:.|:.|.:.     |::.::.:|                             
  Fly   109 -----------VAALRTQHLEA-----HNQAKLRLA----------------------------- 128

  Fly   210 HPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIEHHEHPVSGSDPSGSHGGHS 274
                                                                         |.:|
  Fly   129 -------------------------------------------------------------GDYS 132

  Fly   275 QLPHPVSDTAEVAAAKSLHLQRVHDEGVRNQVLAKIPVAVARSHHVVVPAPVYGYTIPRY-YTP- 337
            ..|.||.||.||||||....:|...|.:||::||:..|.|     :..|.|:...:.|.| |.| 
  Fly   133 VGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLV-----IPNPTPIAVRSQPIYVYQPT 192

  Fly   338 --GFYY 341
              ||.|
  Fly   193 TTGFVY 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 27/46 (59%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134581422
eggNOG 1 0.900 E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.