DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr67B

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster

Alignment Length:166 Identity:47/167 (28%)
Similarity:64/167 (38%) Gaps:29/167 (17%)


  Fly    16 GLALYYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEPLSSKQETRTLDGITQGYYSYRDAA 80
            |..:.:|..|..|..     ...||..:|.|||::|||.:....|.|.|...|...|.|.|....
  Fly    70 GRVIEHPEEYVEEHY-----DAHQYHGQDGLGQFAYGYRDWNQGKNEKRDETGKVTGSYKYVQPH 129

  Fly    81 GKLQTVNYVADNKGFHV-----AATNLPKAKVPQESLEFSPRSASHPVDHHVEHHAEVSHAVVQH 140
            |:....||.||..||||     |...||..|.|         :.....:.|.:...|::.|    
  Fly   130 GRDFVANYYADKTGFHVEDNRPAHLKLPATKTP---------AVLKAEEEHFKLWGELAAA---- 181

  Fly   141 PVGHHPIEVPHHHTVVESGR--SAHPDGHHPVEHHE 174
             .||:|  .|:.....:.||  ...|: :.|..|.|
  Fly   182 -AGHNP--DPYAAEYQQEGRYQPTEPE-YQPYVHEE 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 16/46 (35%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49281
eggNOG 1 0.900 E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.