DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr66D

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster

Alignment Length:124 Identity:30/125 (24%)
Similarity:50/125 (40%) Gaps:23/125 (18%)


  Fly    44 DELGQYSYGY---SEPLSSKQETRTL-DG-ITQGYYSYRDAAGKLQTVNYVADNK-GFHV----- 97
            |:...|.:|:   .:..::.|..:.: || :.:|.||..|:.|.::||.|.||.| ||..     
  Fly   153 DQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIRE 217

  Fly    98 ---AATNLPKAKVPQESLEFSPRSASHPVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHH 153
               ....:|....|.:.|    |:..|....  |:.:..|....||   ....:.|.:|
  Fly   218 PTDIVVKIPTPPPPTQLL----RAGGHKAQQ--EYSSGPSKQQYQH---QQQQQQPQYH 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 17/52 (33%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.