DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:56 Identity:17/56 - (30%)
Similarity:28/56 - (50%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GYSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLPKAKV 107
            |..:.:.::||..    :.:|.||:....|:..||||:||..||.....:||...:
  Fly    56 GQLKNVGTEQEAI----VVRGSYSFVADDGQTYTVNYIADENGFQPEGAHLPNVPI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 13/42 (31%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 13/42 (31%)

Return to query results.
Submit another query.