DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr64Aa

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster

Alignment Length:156 Identity:45/157 (29%)
Similarity:61/157 (39%) Gaps:41/157 (26%)


  Fly     1 MKYPLLLLGSLSLAHGLALYYPYAYTAEGSAVFTPTQRQY----------IAK-------DELGQ 48
            |...|:|:.|..:|...|:..|      |..:..|....|          :||       |...|
  Fly     1 MAQKLILVLSALVAVSSAVVVP------GPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQ 59

  Fly    49 YSYGY------SEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFH--------VA 98
            |::.|      :..:.|:||||:.| :.||.||..:|.|..:.|.|.||. .||:        |.
  Fly    60 YTFSYDVHDGSTGDVKSQQETRSGD-VVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVV 123

  Fly    99 ATNLPKAKV--PQESLEFSPRSASHP 122
            ....|.|||  |...|..||..|..|
  Fly   124 KAVAPVAKVLAPAPLLHASPLVAKVP 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/53 (36%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.